Recombinant Mouse Leukocyte Surface Antigen Cd47 (CD47) Protein (His), Active

Name: Recombinant Mouse Leukocyte Surface Antigen Cd47 (CD47) Protein (His), Active
Brand: Beta LifeScience
SKU: BLC-05697P
Availability: InStock

Greater than 95% as determined by SDS-PAGE.

Collections: All products, Car-nk targets proteins, Cluster of differentiation (cd) proteins, Co-inhibitory receptors, Featured cd protein molecules, Featured immune checkpoint protein molecules, High-quality recombinant proteins, Immune checkpoint proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Mouse Leukocyte Surface Antigen Cd47 (CD47) Protein (His), Active is produced by our Mammalian cell expression system. This is a protein fragment.
Purity	Greater than 95% as determined by SDS-PAGE.
Endotoxin	Less than 1.0 EU/μg as determined by LAL method.
Activity	The ED50 as determined by its ability to bind Mouse SIRPA in functional ELISA is less than 20 ug/ml.
Uniprotkb	Q61735
Target Symbol	CD47
Synonyms	Cd47; Leukocyte surface antigen CD47; Integrin-associated protein; IAP; CD antigen CD47
Species	Mus musculus (Mouse)
Expression System	Mammalian cell
Tag	C-6His
Complete Sequence	QLLFSNVNSIEFTSCNETVVIPCIVRNVEAQSTEEMFVKWKLNKSYIFIYDGNKNSTTTDQNFTSAKISVSDLINGIASLKMDKRDAMVGNYTCEVTELSREGKTVIELKNRTAFNTDQGSACSYEEEKGGCKLVSWFSP
Expression Range	19-158aa
Protein Length	Partial of Isoform 2
Mol. Weight	16.7 kDa
Research Area	Cancer
Form	Lyophilized powder
Buffer	Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Has a role in both cell adhesion by acting as an adhesion receptor for THBS1 on platelets, and in the modulation of integrins. Plays an important role in memory formation and synaptic plasticity in the hippocampus. Receptor for SIRPA, binding to which prevents maturation of immature dendritic cells and inhibits cytokine production by mature dendritic cells. Interaction with SIRPG mediates cell-cell adhesion, enhances superantigen-dependent T-cell-mediated proliferation and costimulates T-cell activation. May play a role in membrane transport and/or integrin dependent signal transduction. May prevent premature elimination of red blood cells. May be involved in membrane permeability changes induced following virus infection.
Subcellular Location	Cell membrane; Multi-pass membrane protein.
Database References	KEGG: mmu:16423 UniGene: PMID: 29105884 Our results support an intrinsic role of CD47 in ovarian cancer progression and immune evasion PMID: 28380460 mice deficient in CD47 (CD47 Knockout) had significantly less brain neutrophil infiltration at 24h, upregulated VEGF expression in peri-lesion cortex at 7 and 14day PMID: 27931776 TSP1 significantly accelerates replicative senescence and associated cell cycle arrest in a CD47-dependent manner. PMID: 27607583 CD47, TSP1, and to a lesser extent SIRPalpha facilitate exosome-mediated myeloid-derived suppressor cells chemotaxis and migration. PMID: 27728760 In pulmonary hypertension TSP1-CD47 is upregulated, and contributes to pulmonary arterial vasculopathy and dysfunction. PMID: 27742621 thrombospondin-1 via CD47 inhibits renal tubular epithelial cell recovery after ischemia reperfusion injury through inhibition of proliferation/self-renewal. PMID: 27259369 these findings have demonstrated how tumor cells inhibit innate sensing in dendritic cells and suggested that the CD47-SIRPalpha axis is critical for dendritic cell-driven antitumor immunity PMID: 28801234 this study shows that CD47 deficiency in tumor stroma promotes tumor progression by enhancing angiogenesis PMID: 27283989 the results obtained by combining bioinformatics and preclinical studies strongly suggest that targeting TSP-1/CD47 axis may represent a valuable therapeutic alternative for hampering melanoma spreading. PMID: 27349907 Treg cells protect dopaminergic neurons against MPP+ neurotoxicity by a cell-to-cell contact mechanism underlying CD47-SIRPA interaction and Rac1/Akt activation. PMID: 28268219 CD47 deficient mice with vaccination showed greater protective efficacy against lethal challenge. PMID: 27194758 These results indicate an important role for CD47-SIRPalpha interactions in innate control of malaria and suggest novel targets for intervention. PMID: 27091932 atherogenesis is associated with upregulation of CD47, a key anti-phagocytic molecule that is known to render malignant cells resistant to programmed cell removal, or 'efferocytosis' PMID: 27437576 Erythrocyte CD47 has a key role in hematoma clearance after intracerebral hemorrhage. PMID: 26732568 These data indicate that CD47 plays protective roles against disseminated candidiasis and alters pro-inflammatory and immunosuppressive pathways known to regulate innate and T cell immunity. PMID: 26010544 CD47 deficiency ameliorates lupus nephritis in Fas(lpr) mice via suppression of IgG autoantibody production. PMID: 26095930 the cell adhesion molecule CD47 participates in multiple phases of granule cell development, including proliferation, migration, and neurite differentiation PMID: 25288019 CD47 mediates signaling from the extracellular matrix that coordinately regulates basal metabolism and cytoprotective responses to radiation injury PMID: 26311851 Taken together, these data revealed a novel role for CD47 in the development of obesity and its related metabolic complications. PMID: 25747123 NF KB mediated CD47 up regulation promotes sorafenib resistance treating hepatocellular carcinoma. PMID: 25902734 Loss of cell surface CD47 clustering formation and binding avidity to SIRPalpha facilitate apoptotic cell clearance by macrophages. PMID: 26085683 findings prove that the TSP-1/CD47/SIRP-alpha signal axis is important to the evolution of tumor cells in the microenvironment of immunotherapy and identify thrombospondin-1 as a key signal PMID: 25697354 Thrombospondin-1 and CD47 signaling regulate healing of thermal injury in mice. PMID: 24840925 the microglial proinflammatory response to Abeta(1-42) protofibril is not dependent on CD47 PMID: 25451248 CD47 expression in the microenvironment was sufficient to limit tumor radiosensitivity. PMID: 25297630 role in promoting left ventricular heart failure by CaKMII-mediated up-regulation of HDAC3 PMID: 24922625 Polymorphism in the innate immune receptor SIRPalpha controls CD47 binding and autoimmunity in the nonobese diabetic mouse. PMID: 25305319 using a syngeneic mouse hepatocyte transplantation model, the present study demonstrates that missing CD47 on donor cells alone can cause recipient myeloid cell activation and graft loss. PMID: 23394628 sought to investigate the effect of Hsp70-peptide complex on the expression of CD172alpha and CD47 receptors in normal peritoneal macrophages (NMO) PMID: 24684700 CD47 plays the pivotal role in the immune evasion of primary effusion lymphoma cells in body cavities. Therapeutic antibody targeting of CD47 could be an effective therapy for PEL. PMID: 24726056 'clustering' SIRPalpha into plasma membrane microdomains is essential for activated monocytes and macrophages to effectively interact with CD47 and initiate intracellular signaling PMID: 24143245 Thrombospondin-1 signaling through CD47 is the first identified endogenous inhibitor of H2S signaling and constitutes a novel mechanism that negatively regulates T cell activation. PMID: 23499828 Data indicate that lack of CD47 strongly impairs SIRPalpha-dependent osteoblast differentiation, deteriorate bone formation, and cause reduced formation of osteoclasts. PMID: 23990469 Thus, CD47 antagonists enable cell self-renewal and reprogramming by overcoming negative regulation of c-Myc and other stem cell transcription factors. PMID: 23591719 CD47 deficiency confers cell survival through the activation of autophagic flux and identifies CD47 blockade as a pharmacological route to modulate autophagy for protecting tissue from radiation injury. PMID: 22874555 Inhibitor of apoptosis proteins (IAPs) and their antagonists regulate spontaneous and tumor necrosis factor (TNF)-induced proinflammatory cytokine and chemokine production PMID: 23275336 CD47 deficiency promotes nerve fiber growth from cultured ventral mesencephalic dopamine neurons. PMID: 23049778 Although polymorphonuclear neutrophil (PMN) transmigration is not delayed in CD47-deficient mice, fewer neutrophils are found in the intestine at the postacute/chronic stage of chronic colitis. PMID: 23203922 CD47(low) status on CD4 effectors is necessary for the contraction/resolution of the immune response in humans and mice. PMID: 22870271 Thrombospondin-1 regulates blood flow via CD47 receptor-mediated activation of NADPH oxidase 1. PMID: 23087362 ectopic expression of murine Cd47 in human hepatocytes selectively favors engraftment upon transplantation into mice, a finding that should have a profound impact on the generation of robust humanized small animal models. PMID: 22535707 Activation of parenchymal CD47 promotes renal ischemia-reperfusion injury. PMID: 22859854 Engagement of endothelial CD47 by its ligands triggers outside-in signals in endothelium, facilitating leukocyte transendothelial migration at sites of inflammation. PMID: 22815286 Data show that CD47(-/-) mice are refractory to experimental autoimmune encephalomyelitis (EAE). PMID: 22734047 Activated CD47 promotes pulmonary arterial hypertension through targeting caveolin-1. PMID: 22215724 CD47(high) status on CD4 T cells identifies functional long-lived memory T cell progenitors. PMID: 22461697 CD47 signalling is dispensable for oral tolerance induction, whereas the expression of CD47 by non-haematopoietic cells is required for intestinal IgA B-cell responses. PMID: 22070457 provides a rational basis for targeting CD47-SIRPalpha interactions, using for instance the antagonistic antibodies against human SIRPalpha described herein, to potentiate the clinical effects of cancer therapeutic antibodies PMID: 22042861 CD47 deletion improves functional recovery from spinal cord injury via an increase in vascular patency, functional locomotor improvements and greater white matter sparing. PMID: 21168495

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.