Recombinant Human Placenta Growth Factor (PGF) Protein (hFc)
Beta LifeScience
SKU/CAT #: BLC-06330P

Greater than 85% as determined by SDS-PAGE.
Recombinant Human Placenta Growth Factor (PGF) Protein (hFc)
Beta LifeScience
SKU/CAT #: BLC-06330P
Regular price
$49200
$492.00
Sale price$9900
$99.00Save $393
/
Product Overview
Description | Recombinant Human Placenta Growth Factor (PGF) Protein (hFc) is produced by our Mammalian cell expression system. This is a protein fragment. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | P49763 |
Target Symbol | PGF |
Species | Homo sapiens (Human) |
Expression System | Mammalian cell |
Tag | C-hFc |
Target Protein Sequence | LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERRRPKGRGKRRREKQRPTDCHLCGDAVPRR |
Expression Range | 19-170aa |
Protein Length | Partial |
Mol. Weight | 45.1 kDa |
Research Area | Cardiovascular |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Growth factor active in angiogenesis and endothelial cell growth, stimulating their proliferation and migration. It binds to the receptor FLT1/VEGFR-1. Isoform PlGF-2 binds NRP1/neuropilin-1 and NRP2/neuropilin-2 in a heparin-dependent manner. Also promotes cell tumor growth. |
Subcellular Location | Secreted. Note=The three isoforms are secreted but PlGF-2 appears to remain cell attached unless released by heparin. |
Protein Families | PDGF/VEGF growth factor family |
Database References | |
Tissue Specificity | While the three isoforms are present in most placental tissues, PlGF-2 is specific to early (8 week) placenta and only PlGF-1 is found in the colon and mammary carcinomas. |
Gene Functions References
- low serum level associated with stillbirth PMID: 28714317
- sFlt-1/PLGF was positively correlated with the severity of preterm preeclampsia. PMID: 30177039
- The relationship between PlGF and preeclampsia differed in women with obesity according to gestational diabetes status, which may suggest different mechanistic pathways to preeclampsia. PMID: 30177064
- A contingent strategy of measuring the sFlt-1/PlGF ratio at 24-28weeks in women previously selected by clinical factors and uterine artery Doppler enables an accurate prediction of preeclampsia/fetal growth restriction. PMID: 30177066
- modest correlation of serum-free PlGF-1 with placental volume and uterine artery Doppler pulsatility index PMID: 28714779
- PGF expression may have a role in lymphatic invasion, poorer response to chemotherapy and unfavorable prognosis of patients with serous epithelial ovarian cancer PMID: 29643276
- A single measurement of sFlt-1/PlGF ratio at third trimester to predict pre-eclampsia and intrauterine growth retardation occurring after 34weeks of pregnancy. PMID: 29674192
- The levels of sFlt-1, PlGF, and the sFlt-1/PlGF ratio in pre-eclamptic women with an onset at < 32 weeks were sig- ni fi cantly di ff erent from those in women with an onset at >/=32-33 weeks. PMID: 29674208
- In urban Mozambican women with symptoms and/or signs suggestive of preeclampsia, low maternal plasma PlGF concentrations are associated with increased risks of adverse pregnancy outcomes, especially early delivery and stillbirth. PMID: 29523269
- An sFlt-1:PlGF ratio above 655 is not predictive of impaired perinatal outcomes, and insufficiently reliable for predicting outcomes in cases with clinical signs of preeclampsia. PMID: 29523274
- The maternal sFlt-1 to PlGF ratio in women with hypertensive disorders in pregnancy carries prognostic value for the development of preeclampsia. PMID: 29523275
- Lower umbilical cord PlGF levels are associated with lower birth weight, deviating fetal growth patterns, and a higher odds of fetal growth retardation. PMID: 28926825
- Data suggest that circulating PGF levels fall by nearly one quarter during term labor (but not during elective caesarean section). PMID: 29277266
- The cross-talk between tumor-associated macrophages and NSCLC cells via PLGF/Flt-1 and TGFbeta receptor signaling may promote the growth and vascularization of NSCLC. PMID: 29991059
- PlGF level showed an inversely proportional effect on the foetal weight. PMID: 28326518
- Recombinant hPlGF-2 significantly improved contractile function and reduced LV end-systolic and end-diastolic volume indices with a concomitant increase in capillary and arteriolar density in ischemic myocardium, without aggravating atherosclerosis. PMID: 28397162
- these data suggest that PlGF may increase non-small cell lung cancer metastasis through SRp40-mediated mRNA splicing of VEGF. PMID: 28861767
- The present study investigated the interplay of VEGF-A165a isoform, the anti-angiogenic VEGF-A165b, placental growth factor (PIGF) and their receptors, VEGFR1 and VEGFR2, on junctional occupancy of VE-cadherin and macromolecular leakage in human endothelial monolayers and the perfused placental microvascular bed. PMID: 29054861
- PIGF enhances TLR-signaling upstream of IKK and contributes to an exaggerated pathologic pro-inflammatory state in response to activation of maternal and fetal mononuclear phagocytes by specific TLR agonists PMID: 28635072
- Lower PIGF and higher PAPP-A and free beta-hCG levels were found in the fetal circulation of near-term severe preeclamptic pregnancies PMID: 27809614
- The early variations of PIGF and soluble fms-like tyrosine kinase-1 concentrations in newly pregnant obstetric antiphospholipid syndrome (oAPS) may help to detect patients at low risk of placenta-mediated complications (PMC). PMID: 28126966
- There is a significant negative correlation between the concentration of sFLt-1 and PIGF in normal pregnancy. PMID: 26434493
- knockdown of PIGF in spheroid body cells derived from two gastric cancer cell lines reduced in vitro tumorigenicity and stemness properties of spheroid body cells such as self-renewal ability, colony forming, migratory, and MMPs activities and decreased ability to differentiation and angiogenesis PMID: 27735991
- Data showed that sFlt-1/PIGF ratio increases with volume overload and persistent hypoxia after surgery with CHD. PMID: 25388629
- Glioma cell-released PIGF can induce Bregs to suppress CD8(+) T cell activities. PMID: 25450457
- VEGF/PIGF levels were higher in neonates exposed to pre-eclampsia, and there was a significant negative correlation between birth weight and VEGF/PIGF levels. PMID: 25354293
- In chronic kidney patients not yet on dialysis, higher serum level of PIGF are associated with increased mortality, but not cardiovascular events. PMID: 25128974
- Soluble flt1 is increased in preeclampsia and is associated with decreased levels of bioactive PIGF. PMID: 24166749
- In high-risk patients the sFlt1/PIGF ratio can be used for an individual risk assessment with regard to PE, HELLP syndrome or IUGR. Serial measurements permit a risk-adapted prenatal care of these patients PMID: 24595913
- Gene expression revealed up-regulation of pro-angiogenic (PGF), anti-apoptotics (BAG-1, BCL-2), heart development (TNNT2, TNNC1) and extracellular matrix remodelling (MMP-2, MMP-7) genes in SM. PMID: 18805052
- In contrast to the effects of hypoxia on PIGF expression in other cells, hypoxia suppresses transcription of PIGF in trophoblasts. Regulation of PIGF transcription under hypoxic conditions is independent of HIF-1. PMID: 19712973
- Antibodies to PIGF may possibly be used as angiogenesis inhibitors. PMID: 18466718
- Human donor myocardium and biopsies from allografts without fibrin deposits express PIGF. PMID: 19201345
- anlalysis of levels of circulating PIGF, SDF-1 and sVCAM-1 in patients with systemic lupus erythematosus PMID: 17964973
- These data suggest that mechanical stretch of bronchial airway epithelial cells induces iNOS expression and induces PIGF release in an erk1/2 activation-dependent manner. PMID: 17028267
- Neither the hyperpermeability in response to simultaneous stimulation of VEGFR-1 and VEGFR-2 nor VEGFR-1-mediated severe inflammation was associated with VEGF-E(NZ7)/PIGF-induced angiogenesis. PMID: 16794222
- Overexpression of VEGF but not PIGF exacerbated the lipopolysaccharide-mediated toxic effects, supporting a pathophysiological role for VEGF in mediating the sepsis phenotype. PMID: 16702604
- Therapeutically administered human PIGF-1 demonstrates a desirable biological activity for promoting the growth of functionally relevant vasculature in mice. PMID: 16702473
- IL-17A, IL-17B, IL-17F and IL-23 in systemic lupus erythematosus patients were examined and the correlation between levels of the investigated cytokines and VEGF, PIGF, as well as number of endothelial cells, was investigated. PMID: 23661335
- Maternal serum sFlt-1 and PlGF are markedly decreased in threatened miscarriage patients. PMID: 21448460
- High PlGF and/or low sFlt-1/PlGF may be used to diagnose Peripartum Cardiomyopathy. PMID: 28552862
- In this context, our results demonstrate that D16F7 markedly inhibits chemotaxis and invasiveness of GBM cells and patient-derived GBM stem cells (GSCs) in response to VEGF-A and PlGF, suggesting that VEGFR-1 might represent a suitable target that deserves further investigation for GBM treatment. PMID: 28797294
- reduced in preeclampsia and fetal growth restriction PMID: 27865093
- Studied serum levels of soluble fms-like tyrosine kinase-1 (sFlt-1) and placental growth factor (PlGF) as markers for early diagnosis of preeclampsia. PMID: 29267975
- A high sFlt-1/PlGF ratio was associated with adverse outcomes and a shorter duration to delivery in early-onset fetal growth restriction. PMID: 28737473
- HIV status had no effect on serum level PMID: 28627965
- low plasma levels at 19-25 and 26-31 weeks of gestation were independent risk factors for a small placenta at >/=35 weeks PMID: 28613009
- Data suggest that expression of PGF is down-regulated in placental trophoblasts from pregnancies complicated by fetal growth retardation compared with control placentas. PMID: 28676532
- placental expression not altered by placental dysfunction PMID: 28494189
- Report sensitivity of sFlt-1/PlGF ratio for diagnosis of preeclampsia and fetal growth restriction. PMID: 28501276