Recombinant Human C-C Motif Chemokine 18 (CCL18) Protein (His)

Name: Recombinant Human C-C Motif Chemokine 18 (CCL18) Protein (His)
Brand: Beta LifeScience
SKU: BLC-08214P
Price: 240.0 USD
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: Back to school. back to lab. ready for results. - advance your research with beta lifescience, Buy cytokines, chemokines, and growth factors for research online, Chemokines and receptors – essential regulators of immune response, High-quality cytokines for advanced research, High-quality recombinant proteins, In-stock recombinant proteins

Price Save $250

Size

100ug

Quantity

Submit an inquiry or email sales for a custom bulk quote. Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human C-C Motif Chemokine 18 (CCL18) Protein (His) is produced by our Yeast expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P55774
Target Symbol	CCL18
Synonyms	Alternative macrophage activation associated CC chemokine 1; Alternative macrophage activation-associated CC chemokine 1; AMAC-1; AMAC1; CC chemokine PARC; CCL18; CCL18(4-69); CCL18_HUMAN; CKb7; DC-CK1; DCCK1 ; DCCK1; Dendritic cell chemokine 1; Macrophage inflammatory protein 4; MIP-4; MIP4; PARC; Pulmonary and activation regulated chemokine; Pulmonary and activation-regulated chemokine; SCYA18; Small inducible cytokine A18 ; Small inducible cytokine A18; Small-inducible cytokine A18
Species	Homo sapiens (Human)
Expression System	Yeast
Tag	N-6His
Target Protein Sequence	AQVGTNKELCCLVYTSWQIPQKFIVDYSETSPQCPKPGVILLTKRGRQICADPNKKWVQKYISDLKLNA
Expression Range	21-89aa
Protein Length	Full Length of Mature Protein
Mol. Weight	9.9kDa
Research Area	Immunology
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Chemotactic factor that attracts lymphocytes but not monocytes or granulocytes. May be involved in B-cell migration into B-cell follicles in lymph nodes. Attracts naive T-lymphocytes toward dendritic cells and activated macrophages in lymph nodes, has chemotactic activity for naive T-cells, CD4+ and CD8+ T-cells and thus may play a role in both humoral and cell-mediated immunity responses.
Subcellular Location	Secreted.
Protein Families	Intercrine beta (chemokine CC) family
Database References	HGNC: 10616 OMIM: 603757 KEGG: hsa:6362 STRING: 9606.ENSP00000004921 UniGene: PMID: 30025750 AMAP1 mediated CCL18-induce activation of NF-kappaB and promoted breast cancer metastasis. PMID: 28834540 results of the study indicate that there could be a relationship between the expression of CCL-18 in nasal turbinate mucosa and the severity of allergic rhinitis PMID: 30102123 chemokine CCL18 can be a mediator of peritoneal membrane failure associated with peritonitis episodes as well as providing a new potential therapeutic target. PMID: 29850544 CCL18 was up-regulated in diffuse large B cell lymphoma and related to poor prognosis PMID: 29504526 Serum C-C motif chemokine ligand 18 (CCL18) was elevated in patients with epithelial ovarian cancer (EOC) and could serve as a new tumor biomarker, which also predicted a poor survival of the patient. PMID: 29036787 In advanced lung adenocarcinoma, infiltration of CCL18(+) tumor-associated macrophages (TAMs) was increased and higher expression of CCL18 by TAMs was associated with a favorable prognosis in lymph-node positive NSCLC PMID: 29970512 This study study discovered a positive feedback loop between CTGF and CCL18 in hepatocellular carcinoma metastasis. PMID: 28837877 All patients with NPC1 mutations had high ChT activity, high CCL18/PARC concentrations and/or Niemann-Pick disease type C suspicion index scores >/=70. PMID: 28222799 findings suggest that these pulmonary markers could be useful to assess CAP severity and, especially YKL-40 and CCL18 by helping predict CAP caused by atypical pathogens PMID: 29324810 PARC activation of neutrophils by sterile immunogenic dying cells drives neutrophil-mediated residual cell killing. PMID: 28234357 Matrigel invasion assays revealed that tumor ECM-educated macrophages efficiently stimulated cancer cell invasion through a mechanism involving CCL18. PMID: 28209528 Our results indicate that CCL18 acts in an autocrine manner via Akt activation to stimulate oral squamous cell carcinoma cell growth and invasion during disease progression PMID: 26919103 Our data indicate that hypoxic inhibition of JMJD3 activity reduces demethylation of H3K27me3, nucleosome removal, and hence induction of the STAT6 target gene CCL18, while induction of other STAT6-inducible genes such as SPINT2 remained unaffected by JMJD3. PMID: 27737800 There was no association between serial CCL18 concentrations with tumor response and overall survival. PMID: 28957436 CCL-18 is a promising biomarker in COPD, as it is associated with frequency of exacerbations, particularly with severe COPD exacerbations requiring hospitalization, as well as with functional parameters and symptom scores. PMID: 28115842 Data suggested that CCL18 upregulated Slug expression to promote epithelial-mesenchymal transition (EMT) and stem cell-like features by activating the mTOR pathway in oral cancer. PMID: 28574664 An increased lung protein expression of PARC in chronic obstructive pulmonary disease patients PMID: 28545096 CCL18 can increase the invasive ability of non-small cell lung cancer cells by binding to its receptor Nir1. PMID: 26756176 Results demonstrate that high levels of CCL18 are present in ovarian cancer (OC) ascites and that CCL18 is an important component of ascites for the ascites-mediated migration of OC cells. Ascites and CCL18 stimulate the phosphorylation and expression of Pyk2, which is critical for mediated CCL18-induced migration. PMID: 27613122 Data suggest that circulating CCL18 and abdominal subcutaneous white adipose tissue-secreted CCL18 correlates with insulin resistance and metabolic syndrome risk score; because CCL18 is macrophage-specific and associates with adipose immune gene expression, it may constitute a marker of adipose tissue inflammation (panniculitis). PMID: 27459538 Cytomegalovirus replication in the allograft causes an intrapulmonary increase of CCL-18 and CCL-20 and a systemic rise of CCL-20 serum levels. Strong intrapulmonary CCL-18 responses are associated with symptomatic HCMV disease, proposing that CCL-18 BALF levels could serve as a marker. PMID: 26910332 Study determined that CCL18 expression was up-regulated in ovarian carcinoma suggesting that CCL18 may play an important role in the pathogenicity of epithelial ovarian cancer through the induction of regulators and the activation of signaling pathways including mTORC2 signaling pathways. PMID: 26457987 CCL18 expression is significantly upregulated in human masticatory mucosa during wound healing PMID: 28005267 release of CCL18 with greater non-small cell lung cancer tumor size is most likely due to the accompanied growth of leukocyte infiltrate PMID: 27630310 this study shows that CCL18 has a correlation with cardiac function in patients with acute anterior myocardial infarction PMID: 27350631 our findings establish a signaling role for CCL18 in gastric cancer cells and identify that the CCL18/ERK1/2/NF-kappaB signaling pathway is essential for tumor invasiveness in gastric cancer cells. PMID: 26242263 CCL18 enhances hepatocellular carcinoma (HCC) cell migration, invasion, and epithelial-mesenchymal transition (EMT) through the expression of PITPNM3 and the activation of the NF-kappaB signaling pathway. PMID: 26449829 our findings suggest that CCL18 released from tumor-associated macrophages promotes angiogenesis and tumor progression in breast cancer. PMID: 26416449 Findings suggest that down-regulation of miR98 and miR27b promotes CCL18-mediated invasion and migration of breast cancer cells. PMID: 26244871 CCL18 is significantly up-regulated in breast cancer vs benign tumors or normal breast. It increased with the size of tumors, the number of lymph node metastasis, and advancing tumor stage. PMID: 26294068 A common CCL18 polymorphism together with intraventricular hemorrhage had an additive influence on cerebral palsy susceptibility. PMID: 26113374 The CCL18 levels in serum and synovial fluid are correlated with the severity of osteoarthritis. PMID: 25794928 Combined functions of CCL18 in mesenchymal and cancer cells might accelerate the progression of PDAC by promoting the epithelial-mesenchymal transition, invasion and migration of pancreatic cancer cells. PMID: 25502147 Increased CCL18 levels characterize chronic Pseudomonas aeruginosa infection and pulmonary obstruction in patients with cystic fibrosis. PMID: 25142483 upregulation of CCL18 may be involved in the malignant progression of prostate cancer. PMID: 25197632 CCL-18 and IGFBP-6 were identified as new potential serum biomarkers for prostate cancer. PMID: 24747338 CCL18 expression was positively correlated with malignancy in EC. PMID: 25275026 Pyk2 and Src are important in CCL18-induced breast cancer metastasis PMID: 24142406 CCL18 is an antimicrobial protein with bacteriocidal activity against E. coli and S. aureus. PMID: 12949249 CCL18 from tumor-associated macrophages induces cancer cell epithelial-mesenchymal transition, forming a positive feedback loop, in coculture systems and humanized mice. PMID: 24823638 Further development of A1AT as a diagnostic biomarker for BCa is warranted. PMID: 24011266 the Cys10-Cys34 disulfide bond is involved in the function of CCL18. PMID: 23742785 genetic polymorphism is associated with lung function in Hutterites, who are a founder population of European descent in North America PMID: 23932459 In patients with systemic sclerosis-related interstitial lung disease, CCL18 was a predictor of short-term decline in forced vital capacity. It was not a longterm prognostic indicator. PMID: 23588945 Data indicate that PYK2 N-terminal domain interacting receptor 1 (Nir1) could induce epithelial-mesenchymal transition by stabilising Snail via the PI3K/Akt/GSK3beta/Snail signalling pathway through binding to CCL18. PMID: 24001613 this review focuses on the potential role, in asthma and lung immunity, of CCL18 a chemokine both constitutively expressed at high levels in the lung and induced in inflammatory conditions PMID: 23786278 Identification of human CCR8 as a CCL18 receptor. PMID: 23999500 A high CCL18 level might be an independent biomarker for predicting better survival of patients with colorectal cancer. PMID: 23433718 CCL18 may be an interesting therapeutic target for NSCLC PMID: 23349697

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.