Recombinant Human C-C Motif Chemokine 18 (CCL18) Protein (His)
Recombinant Human C-C Motif Chemokine 18 (CCL18) Protein (His)
Collections: All products, Buy cytokines, chemokines, and growth factors for research online, Chemokines and receptors – essential regulators of immune response, Christmas & new year research sale — 30% off storewide, High-quality cytokines for advanced research, High-quality recombinant proteins, In-stock recombinant proteins
Submit an inquiry or email sales for a custom bulk quote. Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
| Description | Recombinant Human C-C Motif Chemokine 18 (CCL18) Protein (His) is produced by our Yeast expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | P55774 |
| Target Symbol | CCL18 |
| Synonyms | Alternative macrophage activation associated CC chemokine 1; Alternative macrophage activation-associated CC chemokine 1; AMAC-1; AMAC1; CC chemokine PARC; CCL18; CCL18(4-69); CCL18_HUMAN; CKb7; DC-CK1; DCCK1 ; DCCK1; Dendritic cell chemokine 1; Macrophage inflammatory protein 4; MIP-4; MIP4; PARC; Pulmonary and activation regulated chemokine; Pulmonary and activation-regulated chemokine; SCYA18; Small inducible cytokine A18 ; Small inducible cytokine A18; Small-inducible cytokine A18 |
| Species | Homo sapiens (Human) |
| Expression System | Yeast |
| Tag | N-6His |
| Target Protein Sequence | AQVGTNKELCCLVYTSWQIPQKFIVDYSETSPQCPKPGVILLTKRGRQICADPNKKWVQKYISDLKLNA |
| Expression Range | 21-89aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 9.9kDa |
| Research Area | Immunology |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Chemotactic factor that attracts lymphocytes but not monocytes or granulocytes. May be involved in B-cell migration into B-cell follicles in lymph nodes. Attracts naive T-lymphocytes toward dendritic cells and activated macrophages in lymph nodes, has chemotactic activity for naive T-cells, CD4+ and CD8+ T-cells and thus may play a role in both humoral and cell-mediated immunity responses. |
| Subcellular Location | Secreted. |
| Protein Families | Intercrine beta (chemokine CC) family |
| Database References | HGNC: 10616 OMIM: 603757 KEGG: hsa:6362 STRING: 9606.ENSP00000004921 UniGene: PMID: 30025750 |
