Recombinant Human Complement C5 (C5) Protein (His)

Beta LifeScience SKU/CAT #: BLC-09406P
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SDS-PAGE.

Recombinant Human Complement C5 (C5) Protein (His)

Beta LifeScience SKU/CAT #: BLC-09406P
Regular price $1,170.00 Sale price $240.00Save $930
/
Size

Submit an inquiry or email sales for a custom bulk quote. Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Human Complement C5 (C5) Protein (His) is produced by our Mammalian cell expression system. This is a protein fragment.
Purity Greater than 90% as determined by SDS-PAGE.
Uniprotkb P01031
Target Symbol C5
Synonyms Anaphylatoxin C5a analog; C3 and PZP-like alpha-2-macroglobulin domain-containing protein 4; C5; C5a anaphylatoxin; C5a; C5b; CO5_HUMAN; Complement C5 alpha'' chain; Complement C5; Complement component C5; CPAMD4; prepro-C5
Species Homo sapiens (Human)
Expression System Mammalian cell
Tag N-6His
Target Protein Sequence TLQKKIEEIAAKYKHSVVKKCCYDGACVNNDETCEQRAARISLGPRCIKAFTECCVVASQLRANISHKDMQLGR
Expression Range 678-751aa
Protein Length Partial
Mol. Weight 12.3kDa
Research Area Signal Transduction
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Activation of C5 by a C5 convertase initiates the spontaneous assembly of the late complement components, C5-C9, into the membrane attack complex. C5b has a transient binding site for C6. The C5b-C6 complex is the foundation upon which the lytic complex is assembled.; Derived from proteolytic degradation of complement C5, C5a anaphylatoxin is a mediator of local inflammatory process. Binding to the receptor C5AR1 induces a variety of responses including intracellular calcium release, contraction of smooth muscle, increased vascular permeability, and histamine release from mast cells and basophilic leukocytes. C5a is also a potent chemokine which stimulates the locomotion of polymorphonuclear leukocytes and directs their migration toward sites of inflammation.
Subcellular Location Secreted.
Database References

HGNC: 1331

OMIM: 120900

KEGG: hsa:727

STRING: 9606.ENSP00000223642

UniGene: PMID: 29885865

  • recombinant C5a potentiated TNFalpha-induced NF-kappaB activation in renal tubular epithelial cells PMID: 29031143
  • tumoral C5a is an independent adverse prognostic biomarker for clinical outcome of Clear Cell Renal Cell Carcinoma patients after nephectomy. PMID: 27381421
  • C5a synergises with P. aeruginosa LPS in both PD-L1 expression and the production of IL-10 and TGF-beta. PMID: 27624143
  • these results not only confirm the critical role of C5b-9 in complement-mediated hemolysis and but also highlight the critical role of C5b-9 in inflammasome activation. PMID: 27444648
  • Mean cerebrospinal fluid C5 levels increased in patients with depression and schizophrenia. PMID: 29454970
  • elevated in the cerebrospinal fluid of preterm newborns PMID: 27806664
  • Up-regulation of granulocyte and monocyte CD11b during plasma separation was C5-dependent. PMID: 29575196
  • This study provides the preclinical rationale for the combined blockade of PD-1/PD-L1 and C5a to restore antitumor immune responses, inhibit tumor cell growth, and improve outcomes of patients with lung cancer PMID: 28288993
  • Diagnosis and therapeutic management of neonatal hemochromatosis cannot only be based on C5b9 expression in liver samples as it is not specific of this disease. PMID: 28085791
  • C5a-C5aR enriched clear cell renal cell carcinoma patients significantly had a poorer overall survival and recurrence free survival after nephrectomy. PMID: 27821813
  • C5a/C5aR pathway promotes gastric cancer pathogenesis by suppressing p21/p-p21 expression via activation of PI3K/AKT signaling. PMID: 29031586
  • this study shows that C5 acts in the control of serum triglycerides and cholesterol, liver cholesterol deposition, liver homeostasis and C5 promotes a pro-inflammatory liver environment in our mouse model of alcoholic liver disease PMID: 26896155
  • a library of 61 peptides based on the C-terminus of C5a was assayed for the ability to selectively modulate C5aR2 function. PMID: 27108698
  • Data show the expression of a neoepitope which was exposed on complement C5 (C5) after binding to eculizumab in vivo. PMID: 28610663
  • Plasma levels of sC5b-9 were significantly increased in patients with thrombotic microangiopathy after allogeneic stem cell transplantation. PMID: 28801815
  • C5 gene analysis revealed two novel mutations as causative of C5 deficiency in 3 north African families PMID: 27026170
  • data indicate that properdin enhances platelet/granulocyte aggregates (PGAs) formation via increased production of C5a, and that inhibition of properdin function has therapeutic potential to limit thromboinflammation in diseases characterized by increased PGA formation PMID: 27183616
  • this study shows that complement C5a-induced changes in neutrophil morphology during inflammation PMID: 28671713
  • Increased C5a expression is associated with increased inflammation in cystic fibrosis. PMID: 28278205
  • Our results provide evidence that an intrinsic C5a generation may not be fully blocked by eculizumab in various disease settings. Controlling and fully blocking C5a induced signaling in humans therefore warrants a targeted approach PMID: 28366510
  • These findings, together with data from genomic variation databases, indicate a 0.5-2% prevalence of the Complement factor 5 (C5) p.A252T mutation in heterozygosity in sub-Saharan Africa. Therefore, this mutation may have a relevant role in meningococcal disease susceptibility in this geographical area. PMID: 28369827
  • we found the GG variant contributing to the risk of LAA-subtype ischemic stroke but were unable to find an association between ischemic stroke functional outcome at 90 days and C5 rs17611 variants. PMID: 27901252
  • this study shows that C5a signaling induces apoptosis in brain vascular endothelial cells in experimental lupus PMID: 27213693
  • We determined the genotypes of five polymorphisms (rs12237774, rs17611, rs4837805, rs7026551, and rs1017119) of C5 gene. In univariate analysis, rs17611 was significantly associated with Ischemic Stroke (IS) in the additive model, the dominant model, and recessive model. In this sample of patients, genetic variation of rs17611 in C5 is associated with higher prevalence of IS. PMID: 27768391
  • the complement anaphylatoxin C5a shows an inverse correlation with platelet bound oxLDL. The relationship of oxidized lipids to particular complement components may add to the platelet-lipid interplay in atherogenesis and trigger future clinical and mechanistic studies. PMID: 27025272
  • In an arterial thrombosis model, plasminogen activator administration increased C5a levels. Overall, these findings suggest plasmin bridges thrombosis and the immune response by liberating C5a and inducing MAC assembly. PMID: 27077125
  • C5 rs2269067 GG genotype confers risk for proliferative diabetic retinopathy of type 2 diabetes in Chinese Han population (associated with an elevated C5 mRNA expression and an increased IL-6 production) PMID: 26934706
  • C5a can induce the expression of TLR4 in retinal pigment epithelial cells. PMID: 26487798
  • elevated in the inflammatory lesions of placentas with villitis of unknown etiology PMID: 25725937
  • These results identify complement activation product C5a as a priming signal for RPE cells that allows for subsequent inflammasome activation by stimuli such as lipofuscin-mediated photooxidative damage. PMID: 26565031
  • a significant up-regulation (173 fold increase, p < 0.0001) in the expression of inflammatory complement component 5 (C5) in endometriosis was detected for the first time. PMID: 24316322
  • Complement C5b-9 complex sensitizes 661W photoreceptor cells to both apoptosis and necroptosis. PMID: 25735751
  • complement C5a signaling supports human stem cell pluripotency and survival, and thus may play a key role in shaping early human embryonic development PMID: 25132103
  • Rs2900180 in C5-TRAF1 and linked variants in a 66Kb region were associated with radiographic progression in ACPA-negative RA PMID: 25566937
  • The C5 rs2269067 GG genotype confers risk for AAU in a Chinese population and is associated with an elevated C5 serum concentration and an increased IL-17 production. PMID: 26230759
  • TRAF1/C5 rs10818488 polymorphism is not a genetic risk factor for acquired aplastic anemia in a Chinese population. PMID: 25500258
  • This study shows that individuals homozygously expressing the rheumatoid arthritis risk s17611 allele exhibit increased C5a and decreased C5 in plasma, evidence of increased C5 turnover. PMID: 25725109
  • Elevated sC5b-9 levels are indicative of active disease in atypical hemolytic uremic syndrome. PMID: 25818678
  • In conclusion, the present study indicates that C5a may promote the proliferation of breast cancer cells through Akt1 activation of the RGC-32 gene. PMID: 25230890
  • C5A is released from C5 by a cancer cell membrane bound serine protease which enchances neoplasm invasiveness, immune evasion, and neovascularization. PMID: 25050844
  • The interaction between S1P and C5a plays an important role in neutrophils for antineutrophil cytoplasmic antibody -mediated activation PMID: 25000985
  • Our data provide new insights into the regulatory role of C5a in PMN function during systemic C. albicans infection in human blood and identify C5a as an essential mediator of PMN activation in response to C. albicans. PMID: 25539819
  • This report includes seven affected families indicating that C5 deficiency is not rare in South Africa. PMID: 25534848
  • This study reveals that the C5 complement protein may play a critical role in mediating white matter injury through inflammation in the setting of chronic cerebral hypoperfusion. PMID: 24386419
  • the role of C5a as an endogenous priming signal that is required for the initiation of uric acid crystal-induced IL-1beta production. PMID: 25229885
  • Spontaneous abortion is associated with elevated systemic C5a and reduced mRNA of complement inhibitory proteins in placenta. PMID: 24802103
  • C5a, but not C5a-des Arg, was able to induce further heteromer formation between complement C5a receptors. PMID: 24060963
  • Data indicate that cholesterol crystals (CC) employed C5a in the release of IL-1beta. PMID: 24554772
  • Serum level of initiating complement factor (C1q) but not complement regulator C5 is deficient in schizophrenic patients. PMID: 23235303
  • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    Recently viewed