Recombinant Human Leukocyte Surface Antigen Cd47 (CD47) Protein (His), Active

Name: Recombinant Human Leukocyte Surface Antigen Cd47 (CD47) Protein (His), Active
Brand: Beta LifeScience
SKU: BLC-05628P
Availability: InStock

Greater than 95% as determined by SDS-PAGE.

Collections: All products, Car-nk targets proteins, Cluster of differentiation (cd) proteins, Co-inhibitory receptors, Featured cd protein molecules, Featured immune checkpoint protein molecules, High-quality recombinant proteins, Immune checkpoint proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Leukocyte Surface Antigen Cd47 (CD47) Protein (His), Active is produced by our Mammalian cell expression system. This is a protein fragment.
Purity	Greater than 95% as determined by SDS-PAGE.
Endotoxin	Less than 1.0 EU/μg as determined by LAL method.
Activity	The ED50 as determined by its ability to bind Human SIRPA in functional ELISA is less than 20 ug/ml.
Uniprotkb	Q08722
Target Symbol	CD47
Synonyms	Antigen identified by monoclonal 1D8; Antigenic surface determinant protein OA3; CD 47; CD47; CD47 antigen (Rh-related antigen; integrin-associated signal transducer); CD47 antigen; CD47 glycoprotein; CD47 molecule; CD47_HUMAN; IAP; Integrin Associated Protein; Integrin associated signal transducer; Integrin-associated protein; Leukocyte surface antigen CD47; MER 6; MER6; OA 3; OA3; OTTHUMP00000041152; OTTHUMP00000041153; Protein MER6; Rh related antigen; Surface antigen identified by monoclonal 1D8
Species	Homo sapiens (Human)
Expression System	Mammalian cell
Tag	C-6His
Complete Sequence	QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP
Expression Range	19-139aa
Protein Length	Partial
Mol. Weight	14.76 kDa
Research Area	Immunology
Form	Lyophilized powder
Buffer	Lyophilized from a 0.2 μm filtered 10 mM Tris-Citrate, 150 mM NaCl, pH 8.0
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Has a role in both cell adhesion by acting as an adhesion receptor for THBS1 on platelets, and in the modulation of integrins. Plays an important role in memory formation and synaptic plasticity in the hippocampus. Receptor for SIRPA, binding to which prevents maturation of immature dendritic cells and inhibits cytokine production by mature dendritic cells. Interaction with SIRPG mediates cell-cell adhesion, enhances superantigen-dependent T-cell-mediated proliferation and costimulates T-cell activation. May play a role in membrane transport and/or integrin dependent signal transduction. May prevent premature elimination of red blood cells. May be involved in membrane permeability changes induced following virus infection.
Subcellular Location	Cell membrane; Multi-pass membrane protein.
Database References	HGNC: 1682 OMIM: 601028 KEGG: hsa:961 STRING: 9606.ENSP00000355361 UniGene: PMID: 28378740 overexpression of human CD200 in donor pigs could constitute a promising strategy for overcoming xenograft rejection. PMID: 28968355 High CD47 expression is associated with the increase in the ability of surviving breast cancer cells to evade innate and adaptive immunity. PMID: 29367423 CD47 expression is decreased on the surface of erythrocytes in obese subjects. These changes in CD47 expression on the erythrocytes surface may be an adaptive response to hyperfibrinogenemia associated with obesity. PMID: 25914268 Results show that the thrombospondin 1 (TSP1) and its receptor CD47 (CD47) axis selectively regulates NADPH oxidase 1 (Nox1) in the regulation of endothelial senescence and suggest potential targets for controlling the aging process at the molecular level. PMID: 29042481 CD47 is overexpressed in primary non-small cell lung cancer (NSCLC) tissues and cell lines, suggesting that CD47 is a promising therapeutic target for NSCLC. PMID: 27411490 Among the various candidate genes involved in acute rejection, CD47 inhibits monocyte/macrophage-mediated phagocytosis by identifying the CD47 signal regulatory protein alpha (SIRP-alpha) as self/non-self. Tissue factor pathway inhibitor (TFPI) is involved in the regulation of the coagulation pathway and is able to bind to another ligand of CD47, thrombospondin-1 (TSP-1). PMID: 28393401 Blocking CD47 using antibodies could efficiently induce macrophage-mediated phagocytosis of tumor cells and treat cancers. PMID: 27863402 High CD47 expression is not associated with Fibrolamellar Hepatocellular Carcinoma. PMID: 28801364 TTI-621 (SIRPalphaFc) is a fully human recombinant fusion protein that blocks the CD47-SIRPalpha axis by binding to human CD47 and enhancing phagocytosis of malignant cells..These data indicate that TTI-621 is active across a broad range of human tumors. PMID: 27856600 this review highlights the various functions of CD47, discusses anti-tumor responses generated by both the innate and adaptive immune systems as a consequence of administering anti-CD47 blocking antibody, and finally elaborates on the clinical potential of CD47 blockade. PMID: 28077173 we observed neutrophilic infiltration was slightly increased in anti-CD47 treated tumors compared to IgG control. PMID: 28100392 In pulmonary hypertension TSP1-CD47 is upregulated, and contributes to pulmonary arterial vasculopathy and dysfunction. PMID: 27742621 thrombospondin-1 via CD47 inhibits renal tubular epithelial cell recovery after ischemia reperfusion injury through inhibition of proliferation/self-renewal. PMID: 27259369 Engineering macrophages to eat cancer: from "marker of self" CD47 and phagocytosis to differentiation PMID: 28522599 the results obtained by combining bioinformatics and preclinical studies strongly suggest that targeting TSP-1/CD47 axis may represent a valuable therapeutic alternative for hampering melanoma spreading. PMID: 27349907 Results indicated that surgical resection combined with anti-CD47 blocking immunotherapy promoted an inflammatory response and prolonged survival in xenograft animal model, and is therefore an attractive strategy for clinical translation. PMID: 28076333 Results show that the stronger expression of CD47 by cancer cells and larger number of total macrophages/M2 were independently related to shorter survivals. PMID: 27322955 Prolongation of transient porcine chimerism via transgenic expression of human CD47 in a primate model is associated with an immune modulating effect, leading to markedly prolonged survival of donor swine skin xenografts. PMID: 27232934 CD47 is a promising cancer biomarker, and targeting CD47 presents an effective and potential therapeutic strategy through synthesized mechanisms PMID: 26446381 CD47 seems to mediate fusion mostly through broad contact surfaces between the partners' cell membrane while syncytin-1 mediate fusion through phagocytic-cup like structure. PMID: 27714815 The results suggested a critical role of CD47 in laryngeal squamous cell carcinoma development. PMID: 27855370 Data show that anti-human CD47 antibody B6H12 decreased expression of epidermal growth factor receptor (EGFR) and the stem cell transcription factors. PMID: 26840086 suggest that microglial activation may be partially caused by CD47/signal regulatory protein-alpha- and CD200/CD200R-mediated reductions in the immune inhibitory pathways PMID: 27095555 Our results highlight an underappreciated contribution of the adaptive immune system to anti-CD47 adjuvant therapy and suggest that targeting both innate and adaptive immune checkpoints can potentiate the vaccinal effect of antitumor antibody therapy. PMID: 27091975 Data suggest a reduction in the CD47 antigen/signal-regulatory protein alpha (SIRPalpha) pathway by programmed cell death protein 1 (PD-1) blockade, which regulates Myeloid-derived suppressor cells (MDSCs) and tumor associated macrophages (TAMs). PMID: 26573233 atherogenesis is associated with upregulation of CD47, a key anti-phagocytic molecule that is known to render malignant cells resistant to programmed cell removal, or 'efferocytosis' PMID: 27437576 CD47 is a critical regulator in the metastasis of osteosarcoma and results suggest that targeted inhibition of this antigen by anti-CD47 may be a novel immunotherapeutic approach in the management of this tumor. PMID: 26093091 agents that block the CD47:SIRP-alpha engagement are attractive therapeutic targets as a monotherapy or in combination with additional immune-modulating agents for activating antitumor T cells in vivo PMID: 26116271 CD47 is an adverse prognostic factor and promising therapeutic target in gastric cancer. PMID: 26077800 study demonstrates that antigen-presenting cells(CD47+) in coculture with human macrophages show a CD47 concentration-dependent inhibition of phagocytosis PMID: 25593301 CD47 expression contributes to the lethal breast cancer phenotype that is mediated by HIF-1. PMID: 26512116 CD47 is highly expressed on cancer stem cells, but not on other nonmalignant cells in the pancreas. PMID: 25717063 CD47 mediates signaling from the extracellular matrix that coordinately regulates basal metabolism and cytoprotective responses to radiation injury PMID: 26311851 CD47 has a central role in hydrogen sulfate biosynthesis, regulation and signaling in T cells. PMID: 25747479 Loss of cell surface CD47 clustering formation and binding avidity to SIRPalpha facilitate apoptotic cell clearance by macrophages. PMID: 26085683 While CD47 expression on circulating AML blasts has been shown to be a negative prognostic marker for a very defined population of AML patients with NK AML, CD47 expression on AML BM blasts is not PMID: 25943033 Velcro" engineering of high affinity CD47 ectodomain as signal regulatory protein alpha (SIRPalpha) antagonists that enhance antibody-dependent cellular phagocytosis PMID: 25837251 during translation of CD47, the scaffold function of the 3' UTR facilitates binding of proteins to nascent proteins, to direct their transport or function--and this role of 3' UTRs can be regulated by polyadenylation PMID: 25896326 Report poor prognosis/survival in luminal breast cancer patients with circulating tumor cells co-expressing MET and CD47. PMID: 25230070 Staphylococcal SElX and SSL6 proteins bind cell surface receptors PSGL-1 and CD47, respectively. PMID: 24840181 The thrombospondin-1 receptor CD47 directly or indirectly regulates intercellular communication mediated by the transfer of extracellular vesicles between vascular cells. PMID: 24887393 expression is induced following EBV infection of B cells; ligation cases G1 arres PMID: 24911792 CD47 regulates the epigenetic code by targeting UHRF1. PMID: 25550546 Elevated postinjury thrombospondin 1-CD47 triggering aids differentiation of patients' defective inflammatory CD1a+dendritic cells. PMID: 25001859 the TSP-derived 4N1K peptide effects on cell adhesion and integrin activation are independent of CD47 PMID: 24848268 CD47 associates with and regulates VEGFR2 in T cells. CD47 signaling modulates the ability of VEGF to regulate proliferation and TCR signaling, and autocrine production of vascular endothelial growth factor by T cells contributes to this regulation. PMID: 25200950 Suppression of CD47 by morpholino approach suppressed growth of hepatocellular carcinoma in vivo and exerted a chemosensitization effect through blockade of CTSS/PAR2 signaling. PMID: 24523067 CD47 plays the pivotal role in the immune evasion of primary effusion lymphoma cells in body cavities. Therapeutic antibody targeting of CD47 could be an effective therapy for PEL. PMID: 24726056 Data indicate that CD47 in cis interactions regulate LFA-1 (integrin alphaLbeta2) and VLA-4 (integrin alpha4beta1) integrin affinity, and this process plays a substantial role in the adhesion of T-cells. PMID: 24006483

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.