Recombinant Human 5-Hydroxytryptamine Receptor 1D (HTR1D) Protein (His-KSI)

Name: Recombinant Human 5-Hydroxytryptamine Receptor 1D (HTR1D) Protein (His-KSI)
Brand: Beta LifeScience
SKU: BLC-01242P
Price: 299.0 USD
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Price Save $393

Size

100ug

Product Overview

Description	Recombinant Human 5-Hydroxytryptamine Receptor 1D (HTR1D) Protein (His-KSI) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	P28221
Target Symbol	HTR1D
Synonyms	HTR1D; HTR1DA; HTRL; 5-hydroxytryptamine receptor 1D; 5-HT-1D; 5-HT1D; Serotonin 1D alpha receptor; 5-HT-1D-alpha; Serotonin receptor 1D
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His-KSI
Target Protein Sequence	MSPLNQSAEGLPQEASNRSLNATETSEAWDPRTLQALK
Expression Range	1-38aa
Protein Length	Partial
Mol. Weight	19.5 kDa
Research Area	Others
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	G-protein coupled receptor for 5-hydroxytryptamine (serotonin). Also functions as a receptor for ergot alkaloid derivatives, various anxiolytic and antidepressant drugs and other psychoactive substances. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors, such as adenylate cyclase. Signaling inhibits adenylate cyclase activity. Regulates the release of 5-hydroxytryptamine in the brain, and thereby affects neural activity. May also play a role in regulating the release of other neurotransmitters. May play a role in vasoconstriction.
Subcellular Location	Cell membrane; Multi-pass membrane protein.
Protein Families	G-protein coupled receptor 1 family
Database References	HGNC: 5289 OMIM: 182133 KEGG: hsa:3352 STRING: 9606.ENSP00000313661 UniGene: Hs.121482
Tissue Specificity	Detected in brain neocortex and caudate nucleus (at protein level).

Gene Functions References

Data show that 5-hydroxytryptamine receptor (5-HT1DR) played an important role in cell invasion via Axin1/beta-catenin/matrix metalloproteinase 7 (MMP-7) pathway. PMID: 26214021
results suggest that 5-HT signaling participates in regulation of overall islet hormone secretion in non- diabetic individuals and over-expression of HTR1D and HTR2A may either contribute to islet dysfunction in T2D PMID: 26206285
study identified the presence of genetic association at chromosome 1p36 with migraine with aura (P=0.045, Bonferroni corrected): the locus encoding the 5HT(1D) receptor gene PMID: 22107845
This study reveals sex-specific alterations in gene expression of the pre-synaptic 5-HT1D autoreceptors and 5-HT-related transcription factors, NUDR and REST, in dorsal raphe neurons of women with major depression disorder. PMID: 19878438
Gene may be linked to etiology of anorexia nervosa. PMID: 12740597
Polymorphisms in the serotonin 5-HT1D receptor gene are preferentially transmitted in attention-deficit hyperactivity disorder in Chinese Han subjects. PMID: 17099886
The density of 5HT(1D)R was significantly more in tissues known to produce migraine-like pain. 5HT(1D)R-like immunoreactivity was restricted to neuronal fibres, colocalizing with calcitonin gene-related peptide & tyrosine hydroxylase positive fibres. PMID: 18557979
Cell adhesion modulates 5-HT(1D) and P2Y receptor signal trafficking differentially in LTK-8 cells. PMID: 18582865

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.