Biotinylated Recombinant Human Cytomegalovirus Envelope Glycoprotein Ul132 (UL132) Protein (MBP&His-Avi)
Beta LifeScience
SKU/CAT #: BLC-00670P

Greater than 85% as determined by SDS-PAGE.
Biotinylated Recombinant Human Cytomegalovirus Envelope Glycoprotein Ul132 (UL132) Protein (MBP&His-Avi)
Beta LifeScience
SKU/CAT #: BLC-00670P
Regular price
$85000
$850.00
Sale price$9900
$99.00Save $751
/
Product Overview
Description | Biotinylated Recombinant Human Cytomegalovirus Envelope Glycoprotein Ul132 (UL132) Protein (MBP&His-Avi) is produced by our E.coli expression system. This is a protein fragment. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | P69339 |
Target Symbol | UL132 |
Synonyms | (L3) |
Species | Human cytomegalovirus (strain Towne) (HHV-5) (Human herpesvirus 5) |
Expression System | E.coli |
Tag | N-MBP&C-6His-Avi |
Target Protein Sequence | SPYQRLETRDWDEEEEASAARERMKHDPENVIYFRKDGNLDTSFVNPNYGRGSPLTIESHLSDNEEDPIRYYVSVYDELTASEMEEPSNSTSWQIPKLMKVAMQPVSLRDPEYD |
Expression Range | 157-270aa |
Protein Length | Partial |
Mol. Weight | 61.1 kDa |
Research Area | Others |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Subcellular Location | Virion membrane; Single-pass membrane protein. |