Biotinylated Recombinant Human Early Activation Antigen Cd69 (CD69) Protein (MBP&His-Avi)
Biotinylated Recombinant Human Early Activation Antigen Cd69 (CD69) Protein (MBP&His-Avi)
Collections: All products, Avi-tagged proteins, Biotinylated proteins, Christmas & new year research sale — 30% off storewide, Cluster of differentiation (cd) proteins, Featured biotinylated protein molecules, Featured cd protein molecules, High-quality recombinant proteins, In-stock recombinant proteins, Recombinant transmembrane proteins
Submit an inquiry or email sales for a custom bulk quote. Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
| Description | Biotinylated Recombinant Human Early Activation Antigen Cd69 (CD69) Protein (MBP&His-Avi) is produced by our E.coli expression system. This is a protein fragment. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | Q07108 |
| Target Symbol | CD69 |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-MBP&C-6His-Avi |
| Target Protein Sequence | SVGQYNCPGQYTFSMPSDSHVSSCSEDWVGYQRKCYFISTVKRSWTSAQNACSEHGATLAVIDSEKDMNFLKRYAGREEHWVGLKKEPGHPWKWSNGKEFNNWFNVTGSDKCVFLKNTEVSSMECEKNLYWICNKPYK |
| Expression Range | 62-199aa |
| Protein Length | Partial |
| Mol. Weight | 63.7 kDa |
| Research Area | Immunology |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Involved in lymphocyte proliferation and functions as a signal transmitting receptor in lymphocytes, natural killer (NK) cells, and platelets. |
| Subcellular Location | Membrane; Single-pass type II membrane protein. |
| Database References | HGNC: 1694 OMIM: 107273 KEGG: hsa:969 STRING: 9606.ENSP00000228434 UniGene: PMID: 30015935 |
