Recombinant Cynomolgus monkey FCGRT/FCRN Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-3593P
Recombinant Cynomolgus monkey FCGRT/FCRN Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-3593P
Collections: Fc receptors, Featured fc receptors molecules, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Cynomolgus monkey |
Accession | Q8SPV9 |
Synonym | Alpha chain Fc fragment of IgG, receptor transporter, alpha FCGRN_HUMAN FCGRT FcRn FcRn alpha chain FCRN, alpha chain IgG Fc fragment receptor transporter alpha chain IgG Gc receptor IgG receptor FcRn large subunit p51 IgG receptor FcRn large subunit p51 precursor Immunoglobulin receptor, intestinal, heavy chain Neonatal Fc receptor |
Description | Recombinant Cynomolgus monkey FCGRT/FCRN Protein (Tagged) was expressed in Mammalian. It is a Protein fragment |
Source | Mammalian |
AA Sequence | AESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYDSLRGQAEPCGA WVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELSP DNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANK ELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPGNPGFSVLTCSA FSFYPPELQLRFLRNGMAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHY CCIVQHAGLAQPLRVELETPAKSS |
Molecular Weight | 40 kDa |
Purity | >90% by SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Cell surface receptor that transfers passive humoral immunity from the mother to the newborn. Binds to the Fc region of monomeric immunoglobulin gamma and mediates its selective uptake from milk. IgG in the milk is bound at the apical surface of the intestinal epithelium. The resultant FcRn-IgG complexes are transcytosed across the intestinal epithelium and IgG is released from FcRn into blood or tissue fluids. Throughout life, contributes to effective humoral immunity by recycling IgG and extending its half-life in the circulation. Mechanistically, monomeric IgG binding to FcRn in acidic endosomes of endothelial and hematopoietic cells recycles IgG to the cell surface where it is released into the circulation. In addition of IgG, regulates homeostasis of the other most abundant circulating protein albumin/ALB. |
Subcellular Location | Cell membrane; Single-pass type I membrane protein. Endosome membrane. |
Protein Families | Immunoglobulin superfamily |
Database References | KEGG: mcf:102128913 UniGene: Mfa.8387 |
Gene Functions References
- None of the non-synonymous variants of FCGRT or B2M found changes in the amino acid residues known to be important for FcRn function, suggesting that substantial inter-animal variability of FcRn is not expected for the cynomolgus macaques analyzed PMID: 24806819
- Characterization and screening of IgG binding to the neonatal Fc receptor. PMID: 24802048