Recombinant Human Low Affinity Immunoglobulin Epsilon Fc Receptor (FCER2) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-10932P
Greater than 85% as determined by SDS-PAGE.
Recombinant Human Low Affinity Immunoglobulin Epsilon Fc Receptor (FCER2) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-10932P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Low Affinity Immunoglobulin Epsilon Fc Receptor (FCER2) Protein (His) is produced by our Mammalian cell expression system. This is a protein fragment. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | P06734 |
| Target Symbol | FCER2 |
| Synonyms | Blast 2; BLAST-2; Blast2; C type lectin domain family 4 member J; C-type lectin domain family 4; C-type lectin domain family 4 member J; C-type lectin domain family 4; member J; CD 23; CD 23A; CD23; CD23 antigen; CD23A; CLEC 4J; CLEC4J; Fc epsilon receptor II; Fc epsilon RII; Fc fragment of IgE; Fc fragment of IgE low affinity II receptor for; Fc fragment of IgE receptor II; Fc fragment of IgE; low affinity II; receptor for (CD23); Fc of IgE; Fc of IgE; low affinity II; receptor for (CD23); Fc receptor IgE low affinity II alpha polypeptide; Fc receptor; IgE; low affinity II; alpha polypeptide; isoform CRA_a; Fc-epsilon-RII; FCE 2; FCE2; FCER 2; Fcer2; FCER2_HUMAN; FCER2A; FceRII; IgE binding factor; IgE receptor lymphocyte; IgE-binding factor; IGEBF; Immunoglobulin E binding factor; Immunoglobulin E receptor; Immunoglobulin E receptor; low affinity II; Immunoglobulin E-binding factor; Immunoglobulin epsilon chain; LEUKOCYTE ANTIGEN CD23; Low Affinity IgE Receptor; Low affinity immunoglobulin epsilon Fc receptor; Low affinity immunoglobulin epsilon Fc receptor membrane bound form; Low affinity immunoglobulin epsilon Fc receptor soluble form; Ly-42; Ly42; Lymphocyte antigen CD23; Lymphocyte IgE receptor; MGC93219 |
| Species | Homo sapiens (Human) |
| Expression System | Mammalian cell |
| Tag | N-6His |
| Target Protein Sequence | DTTQSLKQLEERAARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESMGPDSRPDPDGRLPTPSAPLHS |
| Expression Range | 48-321aa |
| Protein Length | Partial |
| Mol. Weight | 33.2 kDa |
| Research Area | Immunology |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Low-affinity receptor for immunoglobulin E (IgE) and CR2/CD21. Has essential roles in the regulation of IgE production and in the differentiation of B-cells (it is a B-cell-specific antigen). |
| Subcellular Location | Cell membrane; Single-pass type II membrane protein. Cell membrane; Lipid-anchor. Secreted. Note=Also exists as a soluble excreted form, sCD23. |
| Database References | HGNC: 3612 OMIM: 151445 KEGG: hsa:2208 STRING: 9606.ENSP00000264072 UniGene: PMID: 26965583 |
![SDS-PAGE analysis of Human NDUFV1 (Nadh Dehydrogenase [Ubiquinone] Flavoprotein 1, Mitochondrial) - Recombinant Protein, CAT# BLT-08321P, showing >90% purity under 15% SDS-PAGE (Reduced)](http://www.betalifesci.com/cdn/shop/files/1ihmbkjr21vdmc6j_{width}x.jpg?v=1753363793)
