Recombinant Human Low Affinity Immunoglobulin Gamma Fc Region Receptor Ii-B (FCGR2B) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-10925P
Greater than 85% as determined by SDS-PAGE.
Recombinant Human Low Affinity Immunoglobulin Gamma Fc Region Receptor Ii-B (FCGR2B) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-10925P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Low Affinity Immunoglobulin Gamma Fc Region Receptor Ii-B (FCGR2B) Protein (His) is produced by our Mammalian cell expression system. This is a protein fragment. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | P31994 |
| Target Symbol | FCGR2B |
| Synonyms | FCGR2B; CD32; FCG2; IGFR2; Low affinity immunoglobulin gamma Fc region receptor II-b; IgG Fc receptor II-b; CDw32; Fc-gamma RII-b; Fc-gamma-RIIb; FcRII-b; CD antigen CD32 |
| Species | Homo sapiens (Human) |
| Expression System | Mammalian cell |
| Tag | C-6His |
| Target Protein Sequence | APPKAVLKLEPQWINVLQEDSVTLTCRGTHSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPNFSIPQANHSHSGDYHCTGNIGYTLYSSKPVTITVQAP |
| Expression Range | 46-217aa |
| Protein Length | Partial |
| Mol. Weight | 21.6 kDa |
| Research Area | Immunology |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Receptor for the Fc region of complexed or aggregated immunoglobulins gamma. Low affinity receptor. Involved in a variety of effector and regulatory functions such as phagocytosis of immune complexes and modulation of antibody production by B-cells. Binding to this receptor results in down-modulation of previous state of cell activation triggered via antigen receptors on B-cells (BCR), T-cells (TCR) or via another Fc receptor. Isoform IIB1 fails to mediate endocytosis or phagocytosis. Isoform IIB2 does not trigger phagocytosis. |
| Subcellular Location | Cell membrane; Single-pass type I membrane protein. |
| Database References | HGNC: 3618 OMIM: 152700 KEGG: hsa:2213 STRING: 9606.ENSP00000351497 UniGene: PMID: 28372509 |
