Recombinant Human Apolipoprotein C-Iv (APOC4) Protein (His-B2M)
Beta LifeScience
SKU/CAT #: BLC-11126P
Greater than 85% as determined by SDS-PAGE.
Recombinant Human Apolipoprotein C-Iv (APOC4) Protein (His-B2M)
Beta LifeScience
SKU/CAT #: BLC-11126P
Collections: Fc receptors, Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Apolipoprotein C-Iv (APOC4) Protein (His-B2M) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | P55056 |
Target Symbol | APOC4 |
Synonyms | APO C4; Apo CIV; Apo-CIV; APOC 4; ApoC IV; ApoC-IV; APOC4; APOC4_HUMAN; Apolipoprotein C IV; Apolipoprotein C-IV; Apolipoprotein C4 |
Species | Homo sapiens (Human) |
Expression System | E.coli |
Tag | N-6His-B2M |
Target Protein Sequence | CQPEAQEGTLSPPPKLKMSRWSLVRGRMKELLETVVNRTRDGWQWFWSPSTFRGFMQTYYDDHLRDLGPLTKAWFLESKDSLLKKTHSLCPRLVCGDKDQG |
Expression Range | 27-127aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 25.8 |
Research Area | Others |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | May participate in lipoprotein metabolism. |
Subcellular Location | Secreted. |
Protein Families | Apolipoprotein C4 family |
Database References | |
Tissue Specificity | Expressed by the liver and secreted in plasma. |
Gene Functions References
- APOC4 rs1132899 polymorphism was associated with an increased risk of premature coronary artery disease in Chinese subjects. PMID: 26129832
- ApoC-IV overexpression may perturb lipid metabolism leading to lipid accumulation. HCV core protein may modulate ApoC-IV expression through Ku antigen and PPARgamma/RXRalpha complex. PMID: 18809223