Biotinylated Recombinant Human Leukocyte Surface Antigen Cd47 (CD47) Protein (hFc-Avi)
Beta LifeScience
SKU/CAT #: BLC-06354P
Greater than 90% as determined by SDS-PAGE.
Biotinylated Recombinant Human Leukocyte Surface Antigen Cd47 (CD47) Protein (hFc-Avi)
Beta LifeScience
SKU/CAT #: BLC-06354P
Collections: All products, Avi-tagged proteins, Biotinylated proteins, Car-nk targets proteins, Cluster of differentiation (cd) proteins, Co-inhibitory receptors, Featured biotinylated protein molecules, Featured cd protein molecules, Featured immune checkpoint protein molecules, High-quality recombinant proteins, Immune checkpoint proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Biotinylated Recombinant Human Leukocyte Surface Antigen Cd47 (CD47) Protein (hFc-Avi) is produced by our Mammalian cell expression system. This is a protein fragment. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | Q08722 |
| Target Symbol | CD47 |
| Species | Homo sapiens (Human) |
| Expression System | Mammalian cell |
| Tag | C-hFC-Avi |
| Target Protein Sequence | QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP |
| Expression Range | 19-139aa |
| Protein Length | Partial |
| Mol. Weight | 43.3 kDa |
| Research Area | Cancer |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Has a role in both cell adhesion by acting as an adhesion receptor for THBS1 on platelets, and in the modulation of integrins. Plays an important role in memory formation and synaptic plasticity in the hippocampus. Receptor for SIRPA, binding to which prevents maturation of immature dendritic cells and inhibits cytokine production by mature dendritic cells. Interaction with SIRPG mediates cell-cell adhesion, enhances superantigen-dependent T-cell-mediated proliferation and costimulates T-cell activation. May play a role in membrane transport and/or integrin dependent signal transduction. May prevent premature elimination of red blood cells. May be involved in membrane permeability changes induced following virus infection. |
| Subcellular Location | Cell membrane; Multi-pass membrane protein. |
| Database References | HGNC: 1682 OMIM: 601028 KEGG: hsa:961 STRING: 9606.ENSP00000355361 UniGene: PMID: 28378740 |
![SDS-PAGE analysis of Human NDUFV1 (Nadh Dehydrogenase [Ubiquinone] Flavoprotein 1, Mitochondrial) - Recombinant Protein, CAT# BLT-08321P, showing >90% purity under 15% SDS-PAGE (Reduced)](http://www.betalifesci.com/cdn/shop/files/1ihmbkjr21vdmc6j_{width}x.jpg?v=1753363793)
