Recombinant Y1-BFP Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-10531P
Recombinant Y1-BFP Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-10531P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Bacteria |
Accession | P80893 |
Description | Recombinant Y1-BFP Protein (His tag) was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MFKGNVQGVGTVENIDKGAKFQSLHGVSLLPIDADLQSHDIIFPEDILEG VTSGELIAINGVRLTVVHTDKSIVRFDINDALELTTLGQLKVGDKVNIEK SFKFGDMTGGRSLSGIVTGVADIVEFIEKENNRQIWIEAPEHLTEFLVEK KYIGVDGVYLVIDAIENNRFCINLLLETDMRWYKKGSKVNIEIPDIAGNW |
Purity | >80% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle. |