Recombinant Saccharomyces Cerevisiae Acyl-Coa-Binding Protein (ACB1) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-08185P
Greater than 90% as determined by SDS-PAGE.
Recombinant Saccharomyces Cerevisiae Acyl-Coa-Binding Protein (ACB1) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-08185P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Saccharomyces Cerevisiae Acyl-Coa-Binding Protein (ACB1) Protein (His) is produced by our Yeast expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | P31787 |
Target Symbol | ACB1 |
Synonyms | ACB1; ACB; YGR037CAcyl-CoA-binding protein; ACBP |
Species | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) |
Expression System | Yeast |
Tag | N-6His |
Target Protein Sequence | MVSQLFEEKAKAVNELPTKPSTDELLELYALYKQATVGDNDKEKPGIFNMKDRYKWEAWENLKGKSQEDAEKEYIALVDQLIAKYSS |
Expression Range | 1-87aa |
Protein Length | Full Length |
Mol. Weight | 12.1kDa |
Research Area | Others |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters. |
Protein Families | ACBP family |
Database References | KEGG: sce:YGR037C STRING: 4932.YGR037C |
Gene Functions References
- These experiments reveal a unique secretory pathway where autophagosomes containing Acb1 evade fusion with the vacuole to prevent cargo degradation. PMID: 20156967
- phospholipid biosynthesis gene expression is modulated either by the Acb1p-acyl-CoA ester complex directly or by its ability to donate acyl-CoA esters to utilizing systems. PMID: 17593018
- study of the cardiolipin species profile in Saccharomyces cerevisiae by using depletion of the acyl-CoA-binding protein Acb1p PMID: 19656950