Recombinant staphylococcus aureus hlgC Protein
Beta LifeScience
SKU/CAT #: BLA-10455P
Recombinant staphylococcus aureus hlgC Protein
Beta LifeScience
SKU/CAT #: BLA-10455P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Staphylococcus aureus |
Accession | Q07227 |
Description | Recombinant staphylococcus aureus hlgC Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | ANDTEDIGKGSDIEIIKRTEDKTSNKWGVTQNIQFDFVKDKKYNKDALIL KMQGFISSRTTYYNYKKTNHVKAMRWPFQYNIGLKTNDKYVSLINYLPKN KIESTNVSQTLGYNIGGNFQSAPSLGGNGSFNYSKSISYTQQNYVSEVEQ QNSKSVLWGVKANSFATESGQKSAFDSDLFVGYKPHSKDPRDYFVPDSEL PPLVQSGFNPSFIATVSHEKGSSDTSEFEITYGRNMDVTHAIKRSTHYGN SYLDGHRVHNAFVNRNYTVKYEVNWKTHEIKVKGQN |
Molecular Weight | 33 kDa |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | Cytotoxicity can be detected in human neutrophils when used in combination with hIg B in a concentration range of 0.03-200 nM. |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -80°C. |