Recombinant Staphylococcus aureus Enterotoxin C2 Protein
Beta LifeScience
SKU/CAT #: BLA-10449P
Recombinant Staphylococcus aureus Enterotoxin C2 Protein
Beta LifeScience
SKU/CAT #: BLA-10449P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Staphylococcus aureus |
Accession | P34071 |
Synonym | entC2 Enterotoxin type C 2 SEC2 |
Description | Recombinant Staphylococcus aureus Enterotoxin C2 Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | ESQPDPTPDELHKSSEFTGTMGNMKYLYDDHYVSATKVMSVDKFLAHDLI YNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKDN VGKVTGGKTCMYGGITKHEGNHFDNGNLQNVLIRVYENKRNTISFEVQTD KKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDM MPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG |
Molecular Weight | 28 kDa |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Staphylococcal enterotoxin that activates the host immune system by binding as unprocessed molecules to major histocompatibility (MHC) complex class II and T-cell receptor (TCR) molecules. In turn, this ternary complex activates a large number of T-lymphocytes initiating a systemic release of proinflammatory cytokines. Causes also the intoxication staphylococcal food poisoning syndrome. |
Subcellular Location | Secreted. |
Protein Families | Staphylococcal/streptococcal toxin family |