Recombinant S. cerevisiae TXNRD1 Protein
Beta LifeScience
SKU/CAT #: BLA-10415P
Recombinant S. cerevisiae TXNRD1 Protein
Beta LifeScience
SKU/CAT #: BLA-10415P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Saccharomyces cerevisiae |
Accession | P29509 |
Synonym | cytoplasmic Gene associated with retinoic and IFN-induced mortality 12 protein Gene associated with retinoic and interferon-induced mortality 12 protein Gene associated with retinoid IFN induced mortality 12 protein GRIM 12 GRIM-12 GRIM12 KDRF KM 102 derived reductase like factor KM-102-derived reductase-like factor MGC9145 Oxidoreductase Thioredoxin reductase 1 Thioredoxin reductase 1 cytoplasmic Thioredoxin reductase GRIM 12 Thioredoxin reductase TR1 TR TR 1 TR1 TRXR 1 TRXR1 TRXR1_HUMAN TXNR TXNRD 1 Txnrd1 |
Description | Recombinant S. cerevisiae TXNRD1 Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MVHNKVTIIGSGPAAHTAAIYLARAEIKPILYEGMMANGIAAGGQLTTTT EIENFPGFPDGLTGSELMDRMREQSTKFGTEIITETVSKVDLSSKPFK LWTEFNEDAEPVTTDAIILATGASAKRMHLPGEETYWQKGISACAVCD GAVPIFRNKPLAVIGGGDSACEEAQFLTKYGSKVFMLVRKDHLRASTI MQKRAEKNEKIEILYNTVALEAKGDGKLLNALRIKNTKKNEETDLPVS GLFYAIGHTPATKIVAGQVDTDEAGYIKTVPGSSLTSVPGFFAAGDVQDS KYRQAITSAGSGCMAALDAEKYLTSLE |
Molecular Weight | 34 kDa |
Purity | >95% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | Specific activity : 25.6 U/mg.One unit will cause the oxidation of 1µmole of NADPH per minute by deltaA412/0.0136 x 2. |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle. |