Recombinant S. cerevisiae ndk Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-10409P
Recombinant S. cerevisiae ndk Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-10409P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Saccharomyces cerevisiae |
Accession | P36010 |
Synonym | NDK NDK_ECOLI NDP kinase Nucleoside diphosphate kinase Nucleoside-2-P kinase |
Description | Recombinant S. cerevisiae ndk Protein (Tagged) was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MSSQTERTFIAVKPDGVQRGLVSQILSRFEKKGYKLVAIKLVKADDKLLE QHYAEHVGKPFFPKMVSFMKSGPILATVWEGKDVVRQGRTILGATNPLGS APGTIRGDFGIDLGRNVCHGSDSVDSAEREINLWFKKEELVDWESNQAKW IYE |
Molecular Weight | 37 kDa including tags |
Purity | >85% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate. Required for repair of UV radiation- and etoposide-induced DNA damage. |
Subcellular Location | Cytoplasm. Mitochondrion intermembrane space. Note=Localizes predominantly to the cytoplasm. A small fraction is present in the mitochondrial intermembrane space. |
Protein Families | NDK family |
Database References | KEGG: sce:YKL067W STRING: 4932.YKL067W |
Gene Functions References
- Crystal structure of Ynk1 provides further insights into the interface and interactions between the dimers and the conserved residues involved in quaternary-structure formation. PMID: 18607079
- The study indicates a novel role for YNK1 in DNA repair in yeast, and suggests an anti-mutator function that may contribute to the metastasis suppressor function of NM23-H1 in humans. PMID: 18983998