Recombinant rabbit IL2 Protein
Beta LifeScience
SKU/CAT #: BLA-0973P
Recombinant rabbit IL2 Protein
Beta LifeScience
SKU/CAT #: BLA-0973P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Rabbit |
Accession | O77620 |
Synonym | Aldesleukin IL 2 IL-2 IL2 IL2_HUMAN Interleukin 2 Interleukin-2 interleukin2 Involved in regulation of T cell clonal expansion Lymphokine OTTHUMP00000164090 POIL2 T Cell Growth Factor T-cell growth factor TCGF |
Description | Recombinant rabbit IL2 Protein was expressed in Yeast. It is a Full length protein |
Source | Yeast |
AA Sequence | APTSSSTKETQEQLDQLLLDLQVLLKGVNDYKNSKLSRMLTFKFYMPKKV TELKHLQCLEEELKPLEEVLNLAQGKNSHGGNTRESISNINVTVLKLKGS ETFMCEYDETVTIVEFLNRWITFCQSIISASSS |
Molecular Weight | 15 kDa |
Purity | >95% SDS-PAGE.Purified by ion-exchange chromatography. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | The biological activity of recombinant rabbit IL-2 measured ina cell proliferation assay using CTLL2 mouse cytotoxic T cells.The ED50 for this effect is typically 9.5 - 14.0 ng/mL. |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Produced by T-cells in response to antigenic or mitogenic stimulation, this protein is required for T-cell proliferation and other activities crucial to regulation of the immune response. Can stimulate B-cells, monocytes, lymphokine-activated killer cells, natural killer cells, and glioma cells. |
Subcellular Location | Secreted. |
Protein Families | IL-2 family |
Database References |
Gene Functions References
- IL-2 activates the STAT3 pathway, protects the lens epithelium cells and reduce the damage caused by inflammation reactions. PMID: 18201527