Recombinant Mouse Alpha-2-Macroglobulin Receptor-Associated Protein (LRPAP1) Protein (GFP)

Name: Recombinant Mouse Alpha-2-Macroglobulin Receptor-Associated Protein (LRPAP1) Protein (GFP)
Brand: Beta LifeScience
SKU: BLC-07383P
Price: 1116.0 USD
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Collections: Antibody / cell therapy targets, Car-t cell therapy targets, Recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Mouse Alpha-2-Macroglobulin Receptor-Associated Protein (LRPAP1) Protein (GFP) is produced by our Mammalian cell expression system. This is a protein fragment.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	P55302
Target Symbol	LRPAP1
Species	Mus musculus (Mouse)
Expression System	Mammalian cell
Tag	N-GFP
Target Protein Sequence	GYGSTTEFEEPRVIDLWDLAQSANFTEKELESFREELKHFEAKIEKHNHYQKQLEISHQKLKHVESIGDPEHISRNKEKYVLLEEKTKELGYKVKKHLQDLSSRVSRARHNEL
Expression Range	248-360aa
Protein Length	Partial
Mol. Weight	42.6 kDa
Research Area	Cardiovascular
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Molecular chaperone for LDL receptor-related proteins that may regulate their ligand binding activity along the secretory pathway.
Subcellular Location	Rough endoplasmic reticulum lumen. Endoplasmic reticulum-Golgi intermediate compartment lumen. Golgi apparatus, cis-Golgi network. Golgi apparatus lumen. Endosome lumen. Cell surface.
Protein Families	Alpha-2-MRAP family
Database References	KEGG: mmu:16976 STRING: 10090.ENSMUSP00000030986 UniGene: Mm.277661
Tissue Specificity	Highly expressed in PYS-2 parietal endoderm cells and in the kidney. The RNA level increased about 10-fold during differentiation of F9 embryonal carcinoma cells to parietal endoderm cells.

Gene Functions References

RAP deficiency attenuated atherosclerosis without influencing abdominal aortic aneurysms in hypercholesterolemic mice infused with angiotensin II. PMID: 22153700
Findings reveal that RAP is a novel Abeta-binding protein that promotes cellular internalization of Abeta. PMID: 19826010
In RAP-deficient mice megalin expression was strongly reduced and restricted to a subapical localization and NaP(i)-IIa protein distribution and abundance in the kidney was not altered. PMID: 12748857
the His-sRAP-induced acceleration of megalin-mediated endocytosis causes phosphaturia via altered subcellular distribution of NaPi-II [39-kD receptor-associated protein (RAP)] PMID: 15976002
Results suggest that receptor-associated protein is required for the establishment of thyroglobulin reservoirs, but its absence does not affect hormone secretion. PMID: 16306127
RAP is expressed by thyrocytes in a TSH-dependent manner, both in cultured thyroid cells and in vivo PMID: 17123336
Disruption of the RAP gene determines not only thyroid abnormalities, but also a severe defect of megalin expression and function in the kidney. PMID: 18296906
Receptor-associated protein (RAP) plays a central role in modulating Abeta deposition in APP/PS1 transgenic mice PMID: 18776935

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.