Recombinant Human T-Cell Surface Glycoprotein Cd3 Epsilon Chain (CD3E) Protein (His)

Name: Recombinant Human T-Cell Surface Glycoprotein Cd3 Epsilon Chain (CD3E) Protein (His)
Brand: Beta LifeScience
SKU: BLC-11162P
Price: 418.4 USD
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: Antibody / cell therapy targets, Antibody therapeutic / adc target proteins, Cluster of differentiation (cd) proteins, Featured cd protein molecules, Recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human T-Cell Surface Glycoprotein Cd3 Epsilon Chain (CD3E) Protein (His) is produced by our E.coli expression system. This is a extracellular protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P07766
Target Symbol	CD3E
Synonyms	CD3 epsilon; CD3e; CD3e antigen; CD3e antigen epsilon polypeptide (TiT3 complex); CD3E antigen epsilon polypeptide; CD3E antigen, epsilon subunit; CD3e molecule epsilon; CD3e molecule, epsilon (CD3 TCR complex); CD3e molecule, epsilon (CD3-TCR complex); CD3E_HUMAN; IMD18; T cell antigen receptor complex epsilon subunit of T3; T cell surface antigen T3/Leu 4 epsilon chain; T cell surface glycoprotein CD3 epsilon chain; T-cell surface antigen T3/Leu-4 epsilon chain; T-cell surface glycoprotein CD3 epsilon chain; T3E; TCRE
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His
Target Protein Sequence	DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMD
Expression Range	23-126aa
Protein Length	Extracellular Domain
Mol. Weight	15.8
Research Area	Immunology
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Part of the TCR-CD3 complex present on T-lymphocyte cell surface that plays an essential role in adaptive immune response. When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G and CD3Z. All CD3 chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain. Upon TCR engagement, these motifs become phosphorylated by Src family protein tyrosine kinases LCK and FYN, resulting in the activation of downstream signaling pathways. In addition of this role of signal transduction in T-cell activation, CD3E plays an essential role in correct T-cell development. Initiates the TCR-CD3 complex assembly by forming the two heterodimers CD3D/CD3E and CD3G/CD3E. Participates also in internalization and cell surface down-regulation of TCR-CD3 complexes via endocytosis sequences present in CD3E cytosolic region.
Subcellular Location	Cell membrane; Single-pass type I membrane protein.
Database References	HGNC: 1674 OMIM: 186830 KEGG: hsa:916 STRING: 9606.ENSP00000354566 UniGene: Hs.3003
Associated Diseases	Immunodeficiency 18 (IMD18)

Gene Functions References

The ionic CD3-epsilon -Lck interaction controls the phosphorylation level of the T-cell receptor. PMID: 28659468
A novel pathogenic frameshift variant of CD3E gene has been found in two unrelated T-B+ NK+ severe combined immunodeficiency infants from Turkey. PMID: 28597365
the stalk domains of NKp30 and NKp46, another NCR employing CD3zeta for signaling, were not exchangeable without drastic deficiencies in folding, plasma membrane targeting, and/or ligand-induced receptor signaling. PMID: 27754869
The inducible recruitment of WASp to the TCR-CD3 complex is partially dependent of tyrosine phosphorylation of Cd3e. PMID: 26342115
increase. Our results indicate that the change in CD3zeta-chain expression from the baseline is an independent predictor of residual and recurrent head and neck squamous cell carcinoma. PMID: 26888626
Data suggest that HIV-1 gp41 transmembrane domain (TMD) directly interacts with TMDs of the T-cell receptor and it's CD3-antigen co-receptors (delta, gamma, and epsilon); these interactions appear to be involved in immune evasion mechanism of HIV-1. PMID: 26828096
that Nck recruitment to the TCR is fundamental to mount an efficient T cell response in vivo, and that the Nck-CD3epsilon interaction may represent a target for pharmacological modulation of the immune response. PMID: 24470497
ABCB1 homozygous 3435 TT carrier subjects showed the lowest Pgp activity compared with 3435 CT and CC carriers of renal transplant patients. PMID: 23216707
Local changes in the lipid composition of TCR microclusters render the CD3epsilon cytoplasmic domain accessible during early stages of T cell activation. PMID: 23166358
Results show that levels of CD3epsilon, CD25, CD68, and ICAM-1 mRNA in BCC biopsies may predict risk for new basal cell carcinomas. PMID: 21980389
analysis of the transgenic integration site in immunodeficient tgepsilon26 human CD3epsilon transgenic mice PMID: 21203507
Results suggest that generation of CD3varepsilon chain isoforms with different N-terminal sequence and pI is a general phenomenon. PMID: 19616027
Recruitment of Nck by CD3 epsilon reveals a ligand-induced conformational change essential for T cell receptor signaling and synapse formation. PMID: 12110186
T cell receptor can be recruited to a subset of plasma membrane rafts, independently of cell signaling and attendantly to raft clustering PMID: 12499387
SCID is caused by a CD3E deficiency. PMID: 15546002
CD3 expression was strong in normal proximal and distal tubular epithelium and in renal oncocytomas, weak in chromophobe carcinoma, and negative in clear cell carcinomas, in papillary renal cell carcinoma, and in a transitional cell carcinoma. PMID: 16308105
The CD3 epsilon immune recognition receptor cytoplasmic domain binds to acidic and mixed phospholipid vesicles with a binding strength that correlates with the protein net charge and the presence of clustered basic amino acid residues. PMID: 17176095
CD3epsilon-mediated signal transduction pathway is essential for this transformation process PMID: 17507663
Notch-dependent cytoplasmic CD3 expression can only be achieved during the early phase of NK-cell differentiation. PMID: 17630354
In lung adenocarcinoma patients, significant decreases of MFI values for CD3epsilon, but not CD3zeta, were found in CD4+T and CD8+T cells from pleural effusion compared to peripheral blood and in peripheral blood of patients compared to healthy donors. PMID: 17668204
Data show that Nck forms a complex with an atypical PxxDY motif of the CD3epsilon tail, which encompasses Tyr166 within the activation motif and a T-cell receptor endocytosis signal. PMID: 18555270
Data show that anti-CD3 monoclonal antibody (MAb)-mediated chimpanzee T-cell activation is a function of the anti-CD3 MAb isotype and is not governed by Siglec expression. PMID: 18667496
Results revealed that the human CD3 epsilon subunit forms a homodimer structure, which provide insight into our understanding of the molecular assembly of the CD3 molecular complex. PMID: 19724882

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.