Recombinant Mouse Alpha-2-Macroglobulin Receptor-Associated Protein (LRPAP1) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-07655P
Greater than 85% as determined by SDS-PAGE.
Recombinant Mouse Alpha-2-Macroglobulin Receptor-Associated Protein (LRPAP1) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-07655P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Mouse Alpha-2-Macroglobulin Receptor-Associated Protein (LRPAP1) Protein (His&Myc) is produced by our Mammalian cell expression system. This is a protein fragment. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | P55302 |
Target Symbol | LRPAP1 |
Synonyms | Heparin-binding protein 44 |
Species | Mus musculus (Mouse) |
Expression System | Mammalian cell |
Tag | N-10His&C-Myc |
Target Protein Sequence | GYGSTTEFEEPRVIDLWDLAQSANFTEKELESFREELKHFEAKIEKHNHYQKQLEISHQKLKHVESIGDPEHISRNKEKYVLLEEKTKELGYKVKKHLQDLSSRVSRARHNEL |
Expression Range | 248-360aa |
Protein Length | Partial |
Mol. Weight | 19.4 kDa |
Research Area | Cardiovascular |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Molecular chaperone for LDL receptor-related proteins that may regulate their ligand binding activity along the secretory pathway. |
Subcellular Location | Rough endoplasmic reticulum lumen. Endoplasmic reticulum-Golgi intermediate compartment lumen. Golgi apparatus, cis-Golgi network. Golgi apparatus lumen. Endosome lumen. Cell surface. |
Protein Families | Alpha-2-MRAP family |
Database References | |
Tissue Specificity | Highly expressed in PYS-2 parietal endoderm cells and in the kidney. The RNA level increased about 10-fold during differentiation of F9 embryonal carcinoma cells to parietal endoderm cells. |
Gene Functions References
- RAP deficiency attenuated atherosclerosis without influencing abdominal aortic aneurysms in hypercholesterolemic mice infused with angiotensin II. PMID: 22153700
- Findings reveal that RAP is a novel Abeta-binding protein that promotes cellular internalization of Abeta. PMID: 19826010
- In RAP-deficient mice megalin expression was strongly reduced and restricted to a subapical localization and NaP(i)-IIa protein distribution and abundance in the kidney was not altered. PMID: 12748857
- the His-sRAP-induced acceleration of megalin-mediated endocytosis causes phosphaturia via altered subcellular distribution of NaPi-II [39-kD receptor-associated protein (RAP)] PMID: 15976002
- Results suggest that receptor-associated protein is required for the establishment of thyroglobulin reservoirs, but its absence does not affect hormone secretion. PMID: 16306127
- RAP is expressed by thyrocytes in a TSH-dependent manner, both in cultured thyroid cells and in vivo PMID: 17123336
- Disruption of the RAP gene determines not only thyroid abnormalities, but also a severe defect of megalin expression and function in the kidney. PMID: 18296906
- Receptor-associated protein (RAP) plays a central role in modulating Abeta deposition in APP/PS1 transgenic mice PMID: 18776935