Recombinant Rabbit IL17A Protein
Beta LifeScience
SKU/CAT #: BLA-0972P
Recombinant Rabbit IL17A Protein
Beta LifeScience
SKU/CAT #: BLA-0972P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Rabbit |
Synonym | CTLA 8 CTLA-8 CTLA8 cytotoxic T lymphocyte associated antigen 8 Cytotoxic T lymphocyte associated protein 8 Cytotoxic T lymphocyte associated serine esterase 8 Cytotoxic T-lymphocyte-associated antigen 8 IL 17 IL 17A IL-17 IL-17A IL17 IL17_HUMAN Il17a Interleukin 17 (cytotoxic T lymphocyte associated serine esterase 8) interleukin 17A Interleukin-17A interleukin17 Interleukin17A OTTHUMP00000016597 OTTMUSP00000046003 |
Description | Recombinant Rabbit IL17A Protein was expressed in Yeast. It is a Full length protein |
Source | Yeast |
AA Sequence | GIAMPRNPGCPNAEDKNFPQNVKVSLNILNKSVNSRRPSDYYNRSTSPWT LHRNEDHERYPSVIWEAKCRHLGCVNAEGNVDHHMNSVPIQQEILVLRRE SQHCPHSFRLEKMLVAVGCTCVTPIIHHMA |
Molecular Weight | 15 kDa |
Purity | >95% purity as determined by SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle. |