Recombinant Mycobacterium tuberculosis Hypoxic response Protein 1 (Tagged)
Beta LifeScience
SKU/CAT #: BLA-10177P
Recombinant Mycobacterium tuberculosis Hypoxic response Protein 1 (Tagged)
Beta LifeScience
SKU/CAT #: BLA-10177P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Mycobacterium tuberculosis |
Accession | P9WJA3 |
Description | Recombinant Mycobacterium tuberculosis Hypoxic response Protein 1 (Tagged) was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MTTARDIMNAGVTCVGEHETLTAAAQYMREHDIGALPICGDDDRLHGMLT DRDIVIKGLAAGLDPNTATAGELARDSIYYVDANASIQEMLNVMEEHQVR RVPVISEHRLVGIVTEADIARHLPEHAIVQFVKAICSPMALAS |
Molecular Weight | 36 kDa including tags |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Unlike some other CBS-domain containing proteins does not seem to bind AMP. |
Subcellular Location | Secreted. Note=Not seen to be associated with the cell wall. |
Database References | KEGG: mtu:Rv2626c STRING: 83332.Rv2626c |
Gene Functions References
- Mycobacterium tuberculosis protein Rv2626c plays a significant role in stimulating macrophages to provoke a pro-inflammatory response and in mycobacterial survival during infection. PMID: 28671529
- Rv2626c \appears to modulate macrophage effector functions by eliciting both innate and adaptive immune responses PMID: 20201990