Recombinant Mouse TIM 4 Protein (Fc Tag Active)
Beta LifeScience
SKU/CAT #: BLA-10129P
Recombinant Mouse TIM 4 Protein (Fc Tag Active)
Beta LifeScience
SKU/CAT #: BLA-10129P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Mouse |
Accession | Q6U7R4 |
Synonym | SMUCKLER Spleen, mucin-containing, knockout of lymphotoxin protein T cell immunoglobulin and mucin domain containing protein 4 T-cell immunoglobulin and mucin domain containing 4 T-cell immunoglobulin and mucin domain containing molecule T-cell immunoglobulin and mucin domain-containing protein 4 T-cell immunoglobulin and mucin domains-containing protein 4 T-cell membrane protein 4 TIM-4 Tim4 TIMD 4 TIMD-4 Timd4 TIMD4_HUMAN |
Description | Recombinant Mouse TIM 4 Protein (Fc Tag Active) was expressed in CHO cells. It is a Protein fragment |
Source | CHO cells |
AA Sequence | AASEDTIIGFLGQPVTLPCHYLSWSQSRNSMCWGKGSCPNSKCNAELLRT DGTRIISRKSTKYTLLGKVQFGEVSLTISNTNRGDSGVYCCRIEVPGWFN DVKKNVRLELRRATTTKKPTTTTRPTTTPYVTTTTPELLPTTVMTTSVLP TTTPPQTLATTAFSTAVTTCPSTTPGSFSQETTKGSAFTTESETLPASNH SQRSMMTISTDIAVLRPTGSNPGILPSTSQLTTQKTTLTTSESLQKTTKS HQINSRQT |
Molecular Weight | 28 kDa |
Purity | >= 98% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated Human T cells. |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. |