Recombinant Human PERP Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-6872P
Recombinant Human PERP Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-6872P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | Q96FX8 |
Synonym | 1110017A08Rik dJ496H19.1 KCP 1 KCP-1 KCP1 Keratinocyte associated protein 1 Keratinocyte-associated protein 1 Keratinocytes associated protein 1 KRTCAP 1 KRTCAP1 p53 apoptosis effector related to PMP 22 p53 apoptosis effector related to PMP-22 p53 apoptosis effector related to PMP22 P53 induced protein PIGPC1 P53-induced protein PIGPC1 Perp PERP TP53 apoptosis effector PERP_HUMAN PIGPC 1 PIGPC1 RP3 496H19.1 THW TP53 apoptosis effector Transmembrane protein THW |
Description | Recombinant Human PERP Protein (Tagged) was expressed in Cell free. It is a Full length protein |
Source | Cell free |
AA Sequence | MIRCGLACERCRWILPLLLLSAIAFDIIALAGRGWLQSSDHGQTSSLWWK CSQEGGGSGSYEEGCQSLMEYAWGRAAAAMLFCGFIILVICFILSFFALC GPQMLVFLRVIGGLLALAAVFQIISLVIYPVKYTQTFTLHANPAVTYIYN WAYGFGWAATIILIGCAFFFCCLPNYEDDLLGNAKPRYFYTSA |
Molecular Weight | 41 kDa including tags |
Purity | >85% SDS-PAGE.Purified from an in vitro E.coli expression system. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |