Recombinant EBNA2 Protein (Tagged)

Collections: Other recombinant proteins, Recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Host Species	Epstein-Barr virus
Accession	Q69022
Synonym	EBNA2 EBV EBV nuclear antigen 2 Epstein Barr nuclear antigen 2 HHV4 Human Herpesvirus 4
Description	Recombinant EBNA2 Protein (Tagged) was expressed in Yeast. It is a Protein fragment
Source	Yeast
AA Sequence	MPTYYLALHGGQSYNLIVDTDMSGNPSLSVIPTNPYQEQLSNNPLIQLQI VVGENTGAPAPPQPPPPPPPPPPPERRDAWTQEPLPLDMNPLGSDASQGP LASSIRMLCMAQYLLRNARGQQGLLRPLGPQTRSQVTLERQPVHNPRQEA PIILLQSPAPPRFTPVPMVALGHTLQPTPPPRPTLPQPRIPLIIPPRHTN QPATTPPTAPQRLTLGHQLSLPPHPPPHQSTPHCSSDSTGLPPPPTSYSI PSMTLSPEPLPPPAAPAHPLPGVIYDQQALPPTPGPPWWPPVRDPTPTTQ TPPTNTKQGPDQGQGRGRWRGRGRSKGRGRMHKLPEPRRPGPDTSSPSMP QLSPVVSLHQGQGPENSPTPGPSTAGPVCRVTPSATPDISPIHEPESSDS EEPPFLFPSDWYPPTLEPAELDESWEGIFETTESHSSDEENVGGPSKRPR TSTQ
Purity	>85% SDS-PAGE.
Endotoxin	< 1.0 EU per μg of the protein as determined by the LAL method
Formulation	Liquid Solution
Stability	The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution	See related COA
Unit Definition	For Research Use Only
Storage Buffer	Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

Target Details

Target Function	Plays a key role in the activation of the host resting B-cell and stimulation of B-cell proliferation. Acts by up-regulating the expression of viral EBNA1-6, LMP1, LMP2A and LMP2B genes, as well as several host genes including CD21, CD23 and MYC. Activates transcription by acting as an adapter molecule that binds to cellular sequence-specific DNA-binding proteins such as host CBF1, SMARCB1 and SPI1. Once EBNA2 is near promoter sites, its acidic activating domain recruits basal and activation-associated transcription factors TFIIB, TAF40, TFIIH components ERCC2 and ERCC3, and CBP in order to promote transcription. Alternatively, EBNA2 can affect activities of cell cycle regulators and retard cell cycle progression at G2/M phase. It also induces chromosomal instability, by disrupting mitotic checkpoints, multi-nucleation and formation of micronuclei in infected cells.
Subcellular Location	Host nucleus matrix.
Protein Families	Herpesviridae EBNA2 family
Database References	KEGG: vg:5176198

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.