Recombinant DTYMK Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-3633P
Recombinant DTYMK Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-3633P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Bacillus |
Accession | C3LJ02 |
Synonym | CDC8 deoxythymidylate kinase Deoxythymidylate kinase (thymidylate kinase) dTMP kinase Dtymk FLJ44192 KTHY_HUMAN MGC198617 OTTHUMP00000164604 OTTHUMP00000200145 OTTHUMP00000200146 PP3731 Thymidylate kinase TMPK TYMK |
Description | Recombinant DTYMK Protein (His tag) was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MKGLFVTIEGPEGSGKTTLIQSLLPYFEQKEQKVMATREPGGIAISEDIR TILHKQEYTMMEARTEALLYAAARRQHLVEKVMPALNEDYLVLCDRFIDS SLAYQGYARGLGMDKVFEINRFATEDCMPSLTIYLDIEPEVGLARIAKDA GREVNRLDMEDISFHKRVREGYLQVVERFSDRIVLVNADQPMEKLIEEVI QVIEDKLL |
Molecular Weight | 23 kDa |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Phosphorylation of dTMP to form dTDP in both de novo and salvage pathways of dTTP synthesis. |
Protein Families | Thymidylate kinase family |
Database References | KEGG: bah:BAMEG_0039 |