Recombinant Cynomolgus monkey DR3/LARD Protein (Fc Tag)
Beta LifeScience
SKU/CAT #: BLA-3592P
Recombinant Cynomolgus monkey DR3/LARD Protein (Fc Tag)
Beta LifeScience
SKU/CAT #: BLA-3592P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Cynomolgus monkey |
Accession | G7NTB5 |
Synonym | Apo 3 Apo-3 Apo3 Apoptosis inducing receptor Apoptosis inducing receptor AIR Apoptosis mediating receptor Apoptosis mediating receptor DR 3 Apoptosis mediating receptor DR3 Apoptosis mediating receptor TRAMP Apoptosis-inducing receptor AIR Apoptosis-mediating receptor DR3 Apoptosis-mediating receptor TRAMP DDR 3 DDR3 Death domain receptor 3 Death domain receptor 3 soluble form Death receptor 3 Death receptor beta DR 3 DR3 LARD Lymphocyte associated receptor of death Lymphocyte-associated receptor of death Protein WSL Protein WSL-1 TNF receptor superfamily member 25 TNFR25 TNFRSF 12 TNFRSF 25 TNFRSF12 TNFRSF12, formerly TNFRSF25 TNR25_HUMAN TR 3 TR3 TRAMP Translocating chain association membrane protein Tumor necrosis factor receptor superfamily member 12 Tumor necrosis factor receptor superfamily member 25 Tumor necrosis factor receptor superfamily, member 12 (translocating chain association membrane protein) Tumor necrosis factor receptor superfamily, member 12, formerly WSL WSL 1 WSL LR WSL protein WSL1 WSL1 protein WSLLR |
Description | Recombinant Cynomolgus monkey DR3/LARD Protein (Fc Tag) was expressed in HEK293. It is a Protein fragment |
Source | HEK293 |
AA Sequence | QGGTQSPRCDCAGDFHKKNGVFCCRGCPAGHYLKAPCTEPCGNSTCLLCP QDTFLAWENHHNSECARCQACDEQASQVALENCSAVADTRCGCKPGWFVE CQVSQCVSSSPFYCQPCLDCRALHRHTRLLCSRRDTDCGTCLPGFYEHDD GCVSCPTPPPSLSGAPWGAVQSAVPLSVAGGRVG |
Molecular Weight | 46 kDa including tags |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |