Recombinant cow IL6 Protein
Beta LifeScience
SKU/CAT #: BLA-0844P
Recombinant cow IL6 Protein
Beta LifeScience
SKU/CAT #: BLA-0844P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Cow |
Accession | P26892 |
Synonym | Interleukin BSF 2 B cell differentiation factor B cell stimulatory factor 2 B-cell stimulatory factor 2 BSF 2 BSF-2 BSF2 CDF CTL differentiation factor Cytotoxic T cell differentiation factor Hepatocyte stimulating factor Hepatocyte stimulatory factor HGF HSF Hybridoma growth factor Hybridoma growth factor Interferon beta-2 Hybridoma plasmacytoma growth factor IFN-beta-2 IFNB2 IL 6 IL-6 IL6 IL6_HUMAN Interferon beta 2 Interferon beta-2 Interleukin 6 Interleukin 6 (interferon beta 2) Interleukin BSF 2 Interleukin-6 |
Description | Recombinant cow IL6 Protein was expressed in Yeast. It is a Full length protein |
Source | Yeast |
AA Sequence | GPLGEDFKNDTTPGRLLLTTPEKTEALIKRMVDKISAMRKEICEKNDECE SSKETLAENKLNLPKMEEKDGCFQSGFNQAICLIRTTAGLLEYQIYLDYL QNEYEGNQENVRDLRKNIRTLIQILKQKIADLITTPATNTDLLEKMQSSN EWVKNAKIILILRNLENFLQFSLRAIRMK |
Molecular Weight | 21 kDa |
Purity | >95% purity as determined by SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | Bovine and mouse bone marrow-derived macrophages (BMDM) responded to 10 ng/mL ab87933 by up-regulating the expected IL-6 responsive genes IL4R, SOCS3 (RT-PCR) and phospho-Stat3 (Western Blot). |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycle. |