Recombinant Cow IL23 Protein
Beta LifeScience
SKU/CAT #: BLA-0840P
Recombinant Cow IL23 Protein
Beta LifeScience
SKU/CAT #: BLA-0840P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Cow |
Accession | B2MU62 |
Synonym | IL 23 IL 23 A IL 23 subunit alpha IL 23A IL 23p19 IL-23 subunit alpha IL-23-A IL-23p19 IL12B IL23 Il23a IL23A_HUMAN IL23P19 interleukin 12B Interleukin 23 alpha subunit p19 Interleukin 23 p19 subunit interleukin 23 subunit alpha interleukin 23 subunit p19 interleukin six, G CSF related factor Interleukin-23 subunit alpha Interleukin-23 subunit p19 JKA3 induced upon T cell activation MGC79388 P19 SGRF |
Description | Recombinant Cow IL23 Protein was expressed in Yeast. It is a Full length protein |
Source | Yeast |
AA Sequence | RAVSEDSSPAWTRGQQLSQQLCMLAWSAHLPMGHMDLPREEGGDKTTDDV PRIQCEDGCDPQGLRDNSQSCLQRIHRGLVFYEKLLGSDIFTGEPSLLPN GPVDQLHASILGLRELLQPKGHHWETEQTPSPIPSQPWQRLLLRLKILRS LQAFVAVAARVFAHGAATLSP |
Molecular Weight | 19 kDa |
Purity | >95% purity as determined by SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle. |