Recombinant Chlamydia trachomatis omcA Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-3566P
Recombinant Chlamydia trachomatis omcA Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-3566P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Chlamydia trachomatis |
Accession | P0CC05 |
Synonym | 9 kDa cysteine-rich lipoprotein 9kDa-CRP Lipoprotein OmcA Small cysteine-rich outer membrane protein OmcA Small-CRP |
Description | Recombinant Chlamydia trachomatis omcA Protein (His tag) was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | CCRIVDCCFEDPCAPIQCSPCESKKKDVDGGCNSCNGYVPACKPCGGDTH QDAKHGPQARGIPVDGKCRQ |
Molecular Weight | 23 kDa including tags |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | In elementary bodies (EBs, the infectious stage, which is able to survive outside the host cell) provides the structural integrity of the outer envelope through disulfide cross-links with the large cysteine-rich periplasmic protein and the major outer membrane porin. It has been described in publications as the Sarkosyl-insoluble COMC (Chlamydia outer membrane complex), and serves as the functional equivalent of peptidoglycan. |
Subcellular Location | Cell outer membrane; Lipid-anchor. Note=The protein moiety probably penetrates into the periplasm. |
Database References | KEGG: ctr:CT_444 |