Recombinant Cat IP10 Protein
Beta LifeScience
SKU/CAT #: BLA-2132P
Recombinant Cat IP10 Protein
Beta LifeScience
SKU/CAT #: BLA-2132P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Cat |
Accession | XP_003985323.3 |
Synonym | Interferon gamma induced factor MOB1, mouse, homolog of Interferon gamma induced protein 10 10 kDa interferon gamma induced protein 10 kDa interferon gamma-induced protein C X C motif chemokine 10 C7 Chemokine (C X C motif) ligand 10 Chemokine CXC motif ligand 10 Crg 2 CRG2 CXCL10 CXCL10(1-73) CXL10_HUMAN Gamma IP10 Gamma-IP10 gIP 10 GIP10 IFI10 INP 10 INP10 Interferon activated gene 10 Interferon gamma induced cell line Interferon inducible cytokine IP 10 Interferon inducible cytokine IP10 IP 10 IP-10 Mob 1 MOB1 Protein 10 from interferon (gamma) induced cell line SCYB10 Small inducible cytokine B10 Small inducible cytokine B10 precursor Small inducible cytokine subfamily B (Cys X Cys) member 10 Small inducible cytokine subfamily B CXC member 10 Small inducible cytokine subfamily B, member 10 Small-inducible cytokine B10 |
Description | Recombinant Cat IP10 Protein was expressed in Yeast. It is a Full length protein |
Source | Yeast |
AA Sequence | IPLSRTPRCTCIKISELSVNLRSLEKLEVIPASHFCPRVEIIATMKKNGE KTCLNPESKTIKNLVKAISKERSKRSP |
Molecular Weight | 9 kDa |
Purity | >95% SDS-PAGE.Purified by ion-exchange chromatography. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C long term. Avoid freeze / thaw cycle. |