Recombinant A. thaliana HDT2 Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-3511P
Recombinant A. thaliana HDT2 Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-3511P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Arabidopsis thaliana |
Accession | Q56WH4 |
Description | Recombinant A. thaliana HDT2 Protein (His tag) was expressed in Yeast. It is a Full length protein |
Source | Yeast |
AA Sequence | MEFWGVAVTPKNATKVTPEEDSLVHISQASLDCTVKSGESVVLSVTVGGA KLVIGTLSQDKFPQISFDLVFDKEFELSHSGTKANVHFIGYKSPNIEQDD FTSSDDEDVPEAVPAPAPTAVTANGNAGAAVVKADTKPKAKPAEVKPAEE KPESDEEDESDDEDESEEDDDSEKGMDVDEDDSDDDEEEDSEDEEEEETP KKPEPINKKRPNESVSKTPVSGKKAKPAAAPASTPQKTEEKKKGGHTATP HPAKKGGKSPVNANQSPKSGGQSSGGNNNKKPFNSGKQFGGSNNKGSNKG KGKGRA |
Molecular Weight | 34 kDa including tags |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Probably mediates the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. |
Subcellular Location | Nucleus, nucleolus. Nucleus. |
Protein Families | Histone deacetylase HD2 family |
Database References | |
Tissue Specificity | Expressed in leaves, roots, stems, young plantlets, flowers and siliques. Highest levels in ovules, embryos, shoot apical meristems and first leaves. Also expressed in somatic embryos. |
Gene Functions References
- Results suggest that HD2B histone deacetylase plays a role in seed dormancy and/or germinability. PMID: 23464703
- AtDNMT2 interacts with type-2 histone deacetylases (AtHD2s), a unique type of histone deacetylase family in plants. PMID: 20331964