Recombinant Snaclec rhodocytin subunit alpha Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-10436P
Recombinant Snaclec rhodocytin subunit alpha Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-10436P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Malayan pit viper |
Accession | Q9I841 |
Description | Recombinant Snaclec rhodocytin subunit alpha Protein (His tag) was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | GLEDCDFGWSPYDQHCYQAFNEQKTWDEAEKFCRAQENGAHLASIESNGE ADFVSWLISQKDELADEDYVWIGLRAQNKEQQCSSEWSDGSSVSYENLID LHTKKCGALEKLTGFRKWVNYYCEQMHAFVCKLLPY |
Molecular Weight | 32 kDa including tags |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Elicits platelet aggregation by the binding to the C-type lectin domain family 1 member B (CLEC1B/CLEC2). Binding leads to tyrosine phosphorylation in the cytoplasmic tail of CLEC1B, which promotes the binding of spleen tyrosine kinase (Syk), subsequent activation of PLC-gamma-2, and platelet activation and aggregation. Binding to GPIbalpha (GP1BA) and alpha-2/beta-1 (ITGA2/ITGB1) may also induce aggregation, but this is controversial. |
Subcellular Location | Secreted. |
Protein Families | Snaclec family |
Tissue Specificity | Expressed by the venom gland. |