Recombinant S. cerevisiae Smt3 Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-10411P
Recombinant S. cerevisiae Smt3 Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-10411P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Saccharomyces cerevisiae |
Accession | Q12306 |
Synonym | DmSUMO 1 Small Ubiquitin-like modifier SMT3 SMT3_YEAST Ubiquitin like protein of the SUMO family Ubiquitin like protein SMT3 Ubiquitin-like protein SMT3 |
Description | Recombinant S. cerevisiae Smt3 Protein (His tag) was expressed in Yeast. It is a Full length protein |
Source | Yeast |
AA Sequence | SDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEA FAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGG |
Molecular Weight | 13 kDa including tags |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Not known; suppressor of MIF2 mutations. |
Protein Families | Ubiquitin family, SUMO subfamily |
Database References | KEGG: sce:YDR510W STRING: 4932.YDR510W |
Gene Functions References
- the library of Smt3 mutants represents a valuable resource for further exploring the functions of sumoylation in cellular stress response and other SUMO-dependent pathways. PMID: 28166236
- Ulp2 controls the dynamic range of SUMO chain lengths by trimming them from the distal ends PMID: 25833950
- Cdk1 and SUMO (Smt3) regulate Swe1 stability PMID: 21151918
- the Zn(2+) motif of E1 has a role in SUMO adenylation PMID: 20501649
- there are a broad array of cellular processes regulated by SUMO conjugation PMID: 15590687
- A model is proposed for the positive control of the centromeric pool of Top2p, required for high minichromosome segregation fidelity, by Smt3p modification. PMID: 16204216