Recombinant Protein ORF3 (Tagged)
Beta LifeScience
SKU/CAT #: BLA-10243P
Recombinant Protein ORF3 (Tagged)
Beta LifeScience
SKU/CAT #: BLA-10243P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Hepatitis E virus |
Accession | O90299 |
Description | Recombinant Protein ORF3 (Tagged) was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MGSRPWALGLFCCCSSCFCLCCSRHRPVSRLAAVVGGAAAVPAVVSGVTG LILSPSQSPIFIQPTPSPRMSPLRPGLDLVFANPSDHSAPLGATRPSAPP LPHVVDLPQLGPRR |
Molecular Weight | 28 kDa including tags |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Plays critical roles in the final steps of viral release by interacting with host TSG101, a member of the vacuolar protein-sorting pathway and using other cellular host proteins involved in vesicle formation pathway. Acts also as a viroporin and forms ion conductive pores allowing viral particle release. Impairs the generation of type I interferon by downregulating host TLR3 and TLR7 as well as their downstream signaling pathways. |
Subcellular Location | Host endoplasmic reticulum membrane. Host cytoplasm. |
Protein Families | Hepevirus ORF3 protein family |