Recombinant Phosphinotricin Acetyl Transferase Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-10220P
Recombinant Phosphinotricin Acetyl Transferase Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-10220P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Streptomyces hygroscopicus |
Accession | P16426 |
Synonym | PAT Phosphinothricin resistance protein PPT N acetyltransferase |
Description | Recombinant Phosphinotricin Acetyl Transferase Protein (His tag) was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MSPERRPADIRRATEADMPAVCTIVNHYIETSTVNFRTEPQEPQEWTDDL VRLRERYPWLVAEVDGEVAGIAYAGPWKARNAYDWTAESTVYVSPRHQRT GLGSTLYTHLLKSLEAQGFKSVVAVIGLPNDPSVRMHEALGYAPRGMLRA AGFKHGNWHDVGFWQLDFSLPVPPRPVLPVTEI |
Molecular Weight | 25 kDa including tags |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Inactivates phosphinothricin (PPT) by transfer of an acetyl group from acetyl CoA. Can also acetylate demethylphosphinothricin but not PTT or glutamate. This enzyme is an effector of phosphinothricin tripeptide (PTT or bialaphos) resistance. |
Protein Families | Acetyltransferase family, PAT/BAR subfamily |