Recombinant Omp38 Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-10201P
Recombinant Omp38 Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-10201P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Acinetobacter baumannii |
Accession | A3M8K2 |
Description | Recombinant Omp38 Protein (Tagged) was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | ANAGVTVTPLLLGYTFQDSQHNNGGKDGNLTNGPELQDDLFVGAALGIEL TPWLGFEAEYNQVKGDVDGASAGAEYKQKQINGNFYVTSDLITKNYDSKI KPYVLLGAGHYKYDFDGVNRGTRGTSEEGTLGNAGVGAFWRLNDALSLRT EARATYNADEEFWNYTALAGLNVVLGGHLKPAAPVVEVAPVEPTPVTPQP QELTEDLNMELRVFFDTNKSNIKDQYKPEIAKVAEKLSEYPNATARIEGH TDNTGPRKLNERLSLARANSVKSALVNEYNVDASRLSTQGFAWDQPIADN KTKEGRAMNRRVFATITGSRTVVVQPGQEAAAPAAAQ |
Molecular Weight | 53 kDa including tags |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Porin. Induces apoptosis in human cells through caspases-dependent and AIF-dependent pathways. Purified Omp38 enters the cells and localizes to the mitochondria, which leads to a release of proapoptotic molecules such as cytochrome c and AIF (apoptosis-inducing factor). |
Subcellular Location | Cell outer membrane; Multi-pass membrane protein. |
Protein Families | OmpA family |
Database References | KEGG: acb:A1S_2840 |