Recombinant Mycobacterium tuberculosis MPT51/MPB51 antigen Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-10178P
Recombinant Mycobacterium tuberculosis MPT51/MPB51 antigen Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-10178P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Mycobacterium tuberculosis |
Accession | P9WQN6 |
Synonym | fbpC1 fbpD mpt51 MT3910 |
Description | Recombinant Mycobacterium tuberculosis MPT51/MPB51 antigen Protein (Tagged) was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | AEPTAKAAPYENLMVPSPSMGRDIPVAFLAGGPHAVYLLDAFNAGPDVSN WVTAGNAMNTLAGKGISVVAPAGGAYSMYTNWEQDGSKQWDTFLSAELPD WLAANRGLAPGGHAAVGAAQGGYGAMALAAFHPDRFGFAGSMSGFLYPSN TTTNGAIAAGMQQFGGVDTNGMWGAPQLGRWKWHDPWVHASLLAQNNTRV WVWSPTNPGASDPAAMIGQAAEAMGNSRMFYNQYRSVGGHNGHFDFPASG DNGWGSWAPQLGAMSGDIVGAIR |
Molecular Weight | 45 kDa including tags |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | May have a role in host tissue attachment, whereby ligands may include the serum protein fibronectin and small sugars. |
Subcellular Location | Secreted. |
Protein Families | Mycobacterial A85 antigen family |
Database References | KEGG: mtc:MT3910 |