Recombinant Mouse Tumor Necrosis Factor Receptor Superfamily Member 4 (TNFRSF4) Protein (His), Active

Name: Recombinant Mouse Tumor Necrosis Factor Receptor Superfamily Member 4 (TNFRSF4) Protein (His), Active
Brand: Beta LifeScience
SKU: BLC-05698P
Availability: InStock

Greater than 95% as determined by SDS-PAGE.

Collections: All products, Antibody / cell therapy targets, Antibody therapeutic / adc target proteins, Buy cytokines, chemokines, and growth factors for research online, Cluster of differentiation (cd) proteins, Featured cd protein molecules, Featured immune checkpoint protein molecules, High-quality cytokines for advanced research, High-quality recombinant proteins, Immune checkpoint proteins, Tumor necrosis factors and receptors (tnfs)

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Mouse Tumor Necrosis Factor Receptor Superfamily Member 4 (TNFRSF4) Protein (His), Active is produced by our Mammalian cell expression system. This is a extracellular protein.
Purity	Greater than 95% as determined by SDS-PAGE.
Endotoxin	Less than 1.0 EU/μg as determined by LAL method.
Activity	The ED50 as determined by its ability to bind Mouse TNFSF4 in functional ELISA is less than 50 ug/ml.
Uniprotkb	P47741
Target Symbol	TNFRSF4
Synonyms	Tnfrsf4; Ox40; Txgp1; Tumor necrosis factor receptor superfamily member 4; OX40 antigen; OX40L receptor; CD antigen CD134
Species	Mus musculus (Mouse)
Expression System	Mammalian cell
Tag	C-6His
Complete Sequence	VTARRLNCVKHTYPSGHKCCRECQPGHGMVSRCDHTRDTLCHPCETGFYNEAVNYDTCKQCTQCNHRSGSELKQNCTPTQDTVCRCRPGTQPRQDSGYKLGVDCVPCPPGHFSPGNNQACKPWTNCTLSGKQTRHPASDSLDAVCEDRSLLATLLWETQRPTFRPTTVQSTTVWPRTSELPSPPTLVTPEGP
Expression Range	20-211aa
Protein Length	Extracellular Domain
Mol. Weight	22.1 kDa
Research Area	Cancer
Form	Lyophilized powder
Buffer	Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Receptor for TNFSF4/OX40L/GP34. Is a costimulatory molecule implicated in long-term T-cell immunity.
Subcellular Location	Membrane; Single-pass type I membrane protein.
Database References	KEGG: mmu:22163 STRING: 10090.ENSMUSP00000030952 UniGene: PMID: 29344664 Combination therapies that depend on checkpoint inhibitor antibodies (Abs) such as for PD-1 or its ligand (PD-L1) together with immune stimulatory agonist Abs like anti-OX40 are being tested in the clinic to achieve improved antitumor effects PMID: 28848055 High Fat Diet-induced obese mice exhibit increased OX40 expression in adipose tissues and splenic T cells. PMID: 28612217 These data support the hypothesis that the Ox40/Ox40L pathway drives cellular and humoral autoimmune responses during lupus nephritis in NZB/W F1 mice and emphasize the potential clinical value of targeting this pathway in human lupus. PMID: 28696253 OX40 is a death receptor for invariant natural killer T cells and is implicated in pyroptotic cell death. PMID: 28436935 this study shows that OX40 links a costimulatory receptor to a repressive chromatin remodeling pathway, and that that OX40 stimulation inhibits IL-17 and reduces experimental autoimmune encephalomyelitis PMID: 27317259 IFNalphaR1 signaling promoted CXCL9 and CXCL10 synthesis, suggesting that these chemokines might be involved in the LPS and CD134 costimulation response. PMID: 28432083 OX40 and ICOS act in a cooperative, nonredundant manner to maximize and prolong the T follicular helper cell response that is generated after acute virus infection PMID: 27895177 OX40 regulates cardiac remodelling via the modulation of CD4(+) T-lymphocytes. PMID: 27580926 bone marrow-derived mast cell (BMMC)-exosomes facilitated the differentiation of naive CD4+ T cells to Th2 cells by ligation of OX40L and OX40 between BMMC-exosomes and CD4+ T cells and represents a novel mechanism of cell-to-cell communication PMID: 27066504 Crystal structures and NMR data show that the Roquin-1 ROQ domain recognizes hexaloops in the SELEX-derived alternative decay element (ADE) and in an ADE-like variant present in the Ox40 3'-UTR with identical binding modes. PMID: 27010430 The OX40-OX40 ligand interaction up-regulates intracellular levels of reactive oxygen species in atherogenesis. PMID: 25115246 OX40 was highly expressed by intratumoral T cells, particularly those of the FoxP3(+) regulatory T-cell (Treg) lineage. PMID: 24732076 OX40 and IL-7 play synergistic, but distinct roles in the homeostatic proliferation of CD4(+) effector memory T cells PMID: 25103720 OX40-OX40L interaction regulates the expression of NFATc1, which may play a critical role in atherosclerotic plaque formation, and may therefore have implications with pathophysiology of atherosclerosis. PMID: 24045961 OX40 stimulation of virus-specific CD4 T cells promoted expression of the transcriptional repressor Blimp-1 and diverted the majority of cells away from follicular Th cell differentiation. PMID: 24101548 interruption of the OX40-OX40L signaling pathway, with decreases in dietary cholesterol, induces regression of atherosclerosis by induction of IL-5-producing T cells and oxidized low-density lipoprotein-specific IgM and reductions in Th2 and mast cells. PMID: 24068673 OX40-OX40L interaction promotes proliferation and activation of lymphocytes via NFATc1 in ApoE-deficient mice. PMID: 23593329 These data show that OX40-OX40L signaling contributes to the evolution of the adaptive immune response to an allograft via the differential control of alloreactive effector and regulatory T cell survival. PMID: 23817421 These results suggest that OX40 costimulation crucially engages survivin during antigen-mediated Th2 responses PMID: 23616302 mediates responsiveness to respiratory syncytial virus in neonates PMID: 23036746 OX40 facilitates control of a persistent virus infection. PMID: 22969431 Mechanistically, OX40 activated the ubiquitin ligase TRAF6, which triggered induction of the kinase NIK in CD4( ) T cells and the noncanonical transcription factor NF-kappaB pathway; this subsequently led to the generation of T(H)9 cells. PMID: 22842344 Both TNFRSF4 and TNFRSF25 independently and additively costimulate vaccine-induced CD8+ T cell proliferation following both primary and secondary antigen challenge. PMID: 22956587 OX40 (CD134), after ligation by OX40L, assembles a unique complex that not only contains TRAF2, RIP, and IKKalpha/beta/gamma but also CARMA1, MALT1, BCL10, and PKC, molecules previously shown to regulate NF-kappaB activation through the T-cell receptor (TCR). PMID: 21282629 OX40-OX40L interaction can regulate the mRNA and protein expressions of NFATc1 in lymphocytes of ApoE-/- mice. PMID: 21924079 Development of skin lesions was rather more likely explained by deletion of Ikbk2 in skin keratinocytes in OX40(Cre) mice. PMID: 22363815 following OX40 stimulation, blockade of Treg-cell suppression and enhancement of the Tem-cell adjuvant effect both concurred to free DCs from immunosuppression and activate the immune response against the tumor. PMID: 22229156 OX40L and PD-L2 expressed on dendritic cells differentially regulate cytokine production during recall responses in the lung. PMID: 22266281 OX40 engagement in vivo in naive mice induces initial expansion of Foxp3+ regulatory T (Treg) cells, but the expanded Tregs have poor suppressive function and exhibit features of exhaustion which can be prevented by exogenous interleukin (IL)-2. PMID: 22147766 sOX40 inhibits MC degranulation, it may provide an in vivo therapeutic tool in allergic disease. PMID: 21653238 Mxd4 and Mnt upregulation following OX40 engagement most likely increases T-cell survival PMID: 21400495 The vascular OX40/OX40L system plays an important role in the formation of vasa vasorum and subsequent atherosclerosis PMID: 20584752 Activation of OX40 augments Th17 cell function and thereby contributes to ocular inflammation. PMID: 20952591 OX40 is a key factor in shaping Treg sensitivity to IL-2 and promoting cell proliferation and survival. PMID: 20806292 OX40 on not only CD4(+) T cells but also NKT cells is involved in allergic airway inflammation. PMID: 20019337 OX40 plays a key role in the homeostasis of intestinal Foxp3+ T regulatory cells and in suppression of colitis. PMID: 20368580 find that OX40, a marker of both T cell activation and memory, is selectively upregulated in the brain during ECM and its distribution among CD4(+) and CD8(+) T cells accumulated in the brain vasculature is approximately equal PMID: 19710907 role in activation of CD8(+) intraepithelial lymphocytes PMID: 11739485 Engagement of OX40 enhances antigen-specific CD4(+) T cell mobilization/memory development and humoral immunity PMID: 11739496 Dendritic cell-induced CD4+ and CD8+ T cell responses in vivo are strongly amplified when Ox40 signaling is provided through an anti-Ox40 monoclonal antibody. PMID: 11777959 Constitutive interaction of OX40 with its ligand provides a system that plays a potential key role in the immune regulation of various autoimmune diseases. PMID: 12370402 relative importance of CD134 (OX40) and CD137 (4-1BB) in the costimulation of CD4+ and CD8+ T cells under comparable conditions of antigenic stimulation PMID: 12516549 The OX40/OX40L pathway has a broad importance in graft-versus-host disease induction. PMID: 12521997 T-cell stimulation via OX40 engagement during cryptococcosis infection using OX40L fusion protein (OX40L:Ig) promotes cell-mediated immunity and IFN-gamma production by CD4+ T cells, and reduces pathogen burden in the lung and associated eosinophilia. PMID: 12794142 expressed on memory CD4 cells; OX40-OX40L interactions are pivotal to the efficiency of recall responses regulated by memory Th2 cells PMID: 12860930 Interactions mediated by CD134 affect onset and development of experimental allergic encephalomyelitis; Cd134-/- mice show less severe clinical signs of disease and markedly reduced inflammatory infiltrates within the central nervous system. PMID: 14644025 OX40 signals may play a key role in mediating skin allograft rejection in CD28/CD154 double knockout mice. PMID: 14734751 Important roles are revealed for OX40 signals in regulatory T (Treg) cell development, homeostasis, and suppressive activity, showing how OX40 signals can oppose Treg mediated suppression when they are delivered directly to antigen-engaged naive T cells. PMID: 15004159 OX40 is one of the costimulatory molecules that can contribute signals to regulate the accumulation of antigen-reactive CD8 cells during immune responses. PMID: 15067059

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.