Recombinant Mouse Tissue Factor Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-10132P
Recombinant Mouse Tissue Factor Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-10132P
Catalog No.: BLA-10132P
Product Overview
| Host Species | Mouse |
| Accession | P20352 |
| Synonym | CD142 CD142 antigen Coagulation factor III Coagulation factor III (thromboplastin tissue factor) F3 FLJ17960 TF TF_HUMAN TFA Thromboplastin Tissue factor |
| Description | Recombinant Mouse Tissue Factor Protein (His tag) was expressed in Baculovirus infected insect cells. It is a Protein fragment |
| Source | Baculovirus infected insect cells |
| AA Sequence | ADPAGIPEKAFNLTWISTDFKTILEWQPKPTNYTYTVQISDRSRNWKNKC FSTTDTECDLTDEIVKDVTWAYEAKVLSVPRRNSVHGDGDQLVIHGEEPP FTNAPKFLPYRDTNLGQPVIQQFEQDGRKLNVVVKDSLTLVRKNGTFLTL RQVFGKDLGYIITYRKGSSTGKKTNITNTNEFSIDVEEGVSYCFFVQAMI FSRKTNQNSPGSSTVCTEQWKSFLGEHHHHHH |
| Molecular Weight | 26 kDa |
| Purity | >95% SDS-PAGE.Purified by using conventional chromatography techniques. |
| Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
| Formulation | Liquid Solution |
| Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
| Reconstitution | See related COA |
| Unit Definition | For Research Use Only |
| Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. |
