Recombinant Mouse TIM 1 Protein (Fc Tag)
Beta LifeScience
SKU/CAT #: BLA-10127P
Recombinant Mouse TIM 1 Protein (Fc Tag)
Beta LifeScience
SKU/CAT #: BLA-10127P
Catalog No.: BLA-10127P
Product Overview
| Host Species | Mouse |
| Accession | Q5QNS5-2 |
| Synonym | CD365 HAVCR HAVCR 1 HAVcr-1 Havcr1 Hepatitis A virus cellular receptor 1 Kidney injury molecule 1 KIM 1 KIM-1 T cell immunoglobin domain and mucin domain protein 1 T cell immunoglobulin mucin family member 1 T cell immunoglobulin mucin receptor 1 T-cell immunoglobulin and mucin domain-containing protein 1 T-cell membrane protein 1 TIM TIM-1 TIM1 TIMD 1 TIMD-1 TIMD1 TIMD1_HUMAN |
| Description | Recombinant Mouse TIM 1 Protein (Fc Tag) was expressed in CHO cells. It is a Protein fragment |
| Source | CHO cells |
| AA Sequence | YVEVKGVVGHPVTLPCTYSTYRGITTTCWGRGQCPSSACQNTLIWTNGHR VTYQKSSRYNLKGHISEGDVSLTIENSVESDSGLYCCRVEIPGWFNDQKV TFSLQVKPEIPTRPPRRPTTTRPTATGRPTTISTRSTHVPTSTRVSTSTP PTSTHTWTHKPDWNGTVTSSGDTWSNHTEAIPPGKPQKNPT |
| Molecular Weight | 21 kDa |
| Purity | >= 98% SDS-PAGE. |
| Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
| Formulation | Lyophilised |
| Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
| Reconstitution | See related COA |
| Unit Definition | For Research Use Only |
| Storage Buffer | Shipped at 4°C. Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. |
