Recombinant Mouse TIM 1 Protein (Fc Tag)
Beta LifeScience
SKU/CAT #: BLA-10127P
Recombinant Mouse TIM 1 Protein (Fc Tag)
Beta LifeScience
SKU/CAT #: BLA-10127P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Mouse |
Accession | Q5QNS5-2 |
Synonym | CD365 HAVCR HAVCR 1 HAVcr-1 Havcr1 Hepatitis A virus cellular receptor 1 Kidney injury molecule 1 KIM 1 KIM-1 T cell immunoglobin domain and mucin domain protein 1 T cell immunoglobulin mucin family member 1 T cell immunoglobulin mucin receptor 1 T-cell immunoglobulin and mucin domain-containing protein 1 T-cell membrane protein 1 TIM TIM-1 TIM1 TIMD 1 TIMD-1 TIMD1 TIMD1_HUMAN |
Description | Recombinant Mouse TIM 1 Protein (Fc Tag) was expressed in CHO cells. It is a Protein fragment |
Source | CHO cells |
AA Sequence | YVEVKGVVGHPVTLPCTYSTYRGITTTCWGRGQCPSSACQNTLIWTNGHR VTYQKSSRYNLKGHISEGDVSLTIENSVESDSGLYCCRVEIPGWFNDQKV TFSLQVKPEIPTRPPRRPTTTRPTATGRPTTISTRSTHVPTSTRVSTSTP PTSTHTWTHKPDWNGTVTSSGDTWSNHTEAIPPGKPQKNPT |
Molecular Weight | 21 kDa |
Purity | >= 98% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. |