Recombinant Mouse Thrombopoietin Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-10120P
Recombinant Mouse Thrombopoietin Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-10120P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Mouse |
Accession | P40226 |
Synonym | C mpl ligand C-mpl ligand Megakaryocyte colony stimulating factor Megakaryocyte colony-stimulating factor Megakaryocyte growth and development factor Megakaryocyte stimulating factor MGC163194 MGDF MKCSF ML MPL ligand MPLLG Myeloproliferative leukemia virus oncogene ligand Prepro thrombopoietin THCYT1 THPO Thrombopoietin Thrombopoietin nirs variant 1 TPO TPO_HUMAN |
Description | Recombinant Mouse Thrombopoietin Protein (His tag) was expressed in Mammalian. It is a Full length protein |
Source | Mammalian |
AA Sequence | HHHHHHSPVAPACDPRLLNKLLRDSHLLHSRLSQCPDVDPLSIPVLLPAV DFSLGEWKTQTEQSKAQDILGAVSLLLEGVMAARGQLEPSCLSSLLGQLS GQVRLLLGALQGLLGTQLPLQGRTTAHKDPNALFLSLQQLLRGKVRFLLL VEGPTLCVRRTLPTTAVPSSTSQLLTLNKFPNRTSGLLETNFSVTARTAG PGLLSRLQGFRVKITPGQLNQTSRSPVQISGYLNRTHGPVNGTHGLFAGT SLQTLEASDISPGAFNKGSLAFNLQGGLPPSPSLAPDGHTPFPPSPALPT THGSPPQLHPLFPDPSTTMPNSTAPHPVTMYPHPRNLSQET |
Molecular Weight | 36 kDa including tags |
Purity | >95% SDS-PAGE.Lyophilized from a 0.2 µm filtered solution. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C long term. |
Target Details
Target Function | Lineage-specific cytokine affecting the proliferation and maturation of megakaryocytes from their committed progenitor cells. It acts at a late stage of megakaryocyte development. It may be the major physiological regulator of circulating platelets. |
Subcellular Location | Secreted. |
Protein Families | EPO/TPO family |
Database References | |
Tissue Specificity | Found mainly in the liver, kidney and skeletal muscle. |
Gene Functions References
- Increased TPO expression in HSCs following IL-11 exposure could be mimicked or blocked by inhibiting or overexpressing miR-204-5p, respectively... IL-11 promoted Hematopoietic stem cell engraftment in a mouse model of aplastic anemia an effect that was attenuated in cells overexpressing miR-204-5p. PMID: 29217821
- this study assessed the physiological source of thrombopoietin, a key cytokine required for maintaining hematopoietic stem cell . PMID: 29622652
- TPO and its receptor Mpl are dispensable for platelet survival in adult mice PMID: 27344013
- Furthermore, although the contribution of the TPO treated graft to long-term hematological engraftment was reduced, the TPO treated and untreated grafts both contributed significantly to long-term chimerism in vivo. PMID: 25137252
- TPO treatment also promoted the peripheral induction of Foxp3(+) Tregs in conjunction with elevated circulating TGF-beta levels. PMID: 25212676
- novel findings about aspects of TPO action on stem cells PMID: 25564715
- Mpl expression, but not Tpo, is fundamental in the development of JAK2V617F(+) myeloproliferative neoplasms PMID: 25339357
- Thrombopoietin/MPL signaling confers growth and survival capacity to CD41-positive cells in a mouse model of Evi1 leukemia. PMID: 25298035
- Megakaryocytes regulate cell cycle quiescence of hematopoietic stem cell through the production of thrombopoietin. PMID: 25451253
- IEX-1 has a role in activation of Erk and NF-kB pathways, which affects thrombopoietin-promoted NHEJ DNA repair in hematopoietic stem cells PMID: 24184684
- Findings establish that Clock regulates Thpo and Mpl expression in vivo, and demonstrate an important link between the body's circadian timing mechanisms and megakaryopoiesis. PMID: 22284746
- Signal transduction pathway of ERK1/2 participates in the activation of thrombopoietin in inflammatory injury of BV2 cells. PMID: 21507308
- The implication of Tpo as a mediator of neuronal damage in experimental pneumococcal meningitis is reported. PMID: 21149592
- Administration of recombinant human IL11 after supralethal radiation exposure promotes survival in mice: interactive effect with thrombopoietin PMID: 12005542
- glycan domain of thrombopoietin acts in trans to enhance secretion of the hormone and other cytokines PMID: 12101178
- Thrombopoietin expands hematopoietic stem cells after transplantation PMID: 12163458
- p38 mitogen-activated protein kinase (MAPK) was responsible for the TPO-induced Hoxb4 elevation PMID: 12855555
- Mpl stimulation by TPO results in the activation of Lyn kinase, which appears to limit the proliferative response through a signaling cascade that regulates MAPK activity PMID: 14726379
- Thrombopoietin induces HOXA9 nuclear transport in immature hematopoietic cells PMID: 15254242
- mpl-tpo signaling pathways are negatively modulated by lnk PMID: 15337790
- is strongly proapoptotic in the brain, causing death of newly generated neurons through the Ras-extracellular signal-regulated kinase 1/2 pathway PMID: 15642952
- TPO(high) and GATA-1(low) alterations are linked in an upstream-downstream relationship along a pathobiologic pathway leading to development of myelofibrosis PMID: 15665119
- Development of myelofibrosis and osteosclerosis depends on local TPO levels in Bone marrow cells. PMID: 15927672
- Thrombopoietin synthesis is induced by IL-6 in the liver during acute inflammation. PMID: 16022585
- results suggest that a balance in positive and negative signals downstream from the TPO signal plays a role in the regulation of the probability of self-renewal in HSCs PMID: 17284614
- thrombopoietin has a role in mast cell differentiation [review] PMID: 17468237
- Chronic TPO overexpression induces mesangioproliferative glomerulopathy. PMID: 17546634
- roles for FAK in megakaryocyte growth and platelet function, setting the stage for manipulation of this component of the Tpo signaling apparatus for therapeutic benefit. PMID: 17925492
- Transcriptional regulation of bone marrow thrombopoietin by platelet proteins.( PMID: 18410987
- TPO induces HIF-1alpha expression in a manner very similar to that of hypoxia. PMID: 18473128
- thrombopoietin potentiates vasculogenesis by enhancing motility and enlivenment of transplanted endothelial progenitor cells via activation of Akt/mTOR/p70S6kinase signaling pathway PMID: 18773906
- TPO downmodulates c-Myb expression through induction of miR-150. PMID: 18814950