Recombinant Mouse S100 beta Protein

Beta LifeScience SKU/CAT #: BLA-8825P
Recombinant Mouse S100 beta Protein

Recombinant Mouse S100 beta Protein

Beta LifeScience SKU/CAT #: BLA-8825P
Catalog No.: BLA-8825P

Product Overview

Host Species Mouse
Accession P50114
Synonym NEF Protein S100 B Protein S100-B S 100 calcium binding protein beta chain S 100 protein beta chain S-100 protein beta chain S-100 protein subunit beta S100 S100 calcium binding protein beta (neural) S100 calcium-binding protein B S100 protein beta chain S100B S100B_HUMAN S100beta
Description Recombinant Mouse S100 beta Protein was expressed in E.coli. It is a Full length protein
Source E.coli
AA Sequence MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKE QEVVDKVMETLDEDGDGECDFQEFMAFVAMVTTACHEFFEHE
Molecular Weight 11 kDa
Purity >95% purity as determined by SDS-PAGE
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Recently viewed