Recombinant Mouse RSPO1 Protein
Beta LifeScience
SKU/CAT #: BLA-10078P
Recombinant Mouse RSPO1 Protein
Beta LifeScience
SKU/CAT #: BLA-10078P
Catalog No.: BLA-10078P
Product Overview
| Host Species | Mouse |
| Accession | Q9Z132 |
| Synonym | CRISTIN3 FLJ40906 hRspo1 R spondin homolog R spondin homolog (Xenopus laevis) R spondin1 R-spondin-1 Roof plate specific spondin Roof plate-specific spondin-1 RP11-566C13.1 RSPO Rspo1 RSPO1_HUMAN |
| Description | Recombinant Mouse RSPO1 Protein was expressed in CHO cells. It is a Full length protein |
| Source | CHO cells |
| AA Sequence | SRGIKGKRQRRISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERNDIR QVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCQEALYL HKGRCYPACPEGSTAANSTMECGSPAQCEMSEWSPWGPCSKKRKLCGFRK GSEERTRRVLHAPGGDHTTCSDTKETRKCTVRRTPCPEGQKRRKGGQGRR ENANRHPARKNSKEPRSNSRRHKGQQQPQPGTTGPLTSVGPTWAQ |
| Molecular Weight | 27 kDa |
| Purity | >95% SDS-PAGE.>95 % by HPLC. |
| Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
| Bioactivity | This protein enhances BMP-2-mediated differentiation of MC3T3-E1 cells. |
| Formulation | Lyophilised |
| Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
| Reconstitution | See related COA |
| Unit Definition | For Research Use Only |
| Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
