Recombinant Mouse RSPO1 Protein
Beta LifeScience
SKU/CAT #: BLA-10078P
Recombinant Mouse RSPO1 Protein
Beta LifeScience
SKU/CAT #: BLA-10078P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Mouse |
Accession | Q9Z132 |
Synonym | CRISTIN3 FLJ40906 hRspo1 R spondin homolog R spondin homolog (Xenopus laevis) R spondin1 R-spondin-1 Roof plate specific spondin Roof plate-specific spondin-1 RP11-566C13.1 RSPO Rspo1 RSPO1_HUMAN |
Description | Recombinant Mouse RSPO1 Protein was expressed in CHO cells. It is a Full length protein |
Source | CHO cells |
AA Sequence | SRGIKGKRQRRISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERNDIR QVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCQEALYL HKGRCYPACPEGSTAANSTMECGSPAQCEMSEWSPWGPCSKKRKLCGFRK GSEERTRRVLHAPGGDHTTCSDTKETRKCTVRRTPCPEGQKRRKGGQGRR ENANRHPARKNSKEPRSNSRRHKGQQQPQPGTTGPLTSVGPTWAQ |
Molecular Weight | 27 kDa |
Purity | >95% SDS-PAGE.>95 % by HPLC. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | This protein enhances BMP-2-mediated differentiation of MC3T3-E1 cells. |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |