Recombinant Mouse PDK4 Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-10010P
Recombinant Mouse PDK4 Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-10010P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Mouse |
Accession | O70571 |
Synonym | [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 4 FLJ40832 mitochondrial Pdk4 PDK4_HUMAN Pyruvate dehydrogenase [lipoamide] kinase isozyme 4 mitochondrial Pyruvate dehydrogenase kinase 4 Pyruvate dehydrogenase kinase isoenzyme 4 Pyruvate dehydrogenase kinase isoform 4 Pyruvate dehydrogenase kinase isozyme 4 Pyruvate dehydrogenase kinase isozyme 4 mitochondrial |
Description | Recombinant Mouse PDK4 Protein (His tag) was expressed in E.coli. It is a Protein fragment |
Source | E.coli |
AA Sequence | ILEYKDTCTVDPVTNQNLQYFLDRFYMNRISTRMLMNQHILIFSDSKTGN PSHIGSIDPNCDVVAVVQDAFECAKMLCDQYYLTSPELNLTQVNGKFPGQ PIHIVYVPSHLHHMLFELFKNAMRATVEHQENRPSLTPVEATVVLGKEDL TIKISDRGGGVPLRITDRLFSYTYSTAPTPVMDNSRNAPLAGFGYGLPIS RLYAKYFQGDLNLYSMSGYGTDAIIYLKALS |
Molecular Weight | 30 kDa including tags |
Purity | >85% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |