Recombinant Mouse NSE Protein
Beta LifeScience
SKU/CAT #: BLA-9984P
Recombinant Mouse NSE Protein
Beta LifeScience
SKU/CAT #: BLA-9984P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Mouse |
Accession | P17183 |
Synonym | 2 phospho D glycerate hydrolyase 2-phospho-D-glycerate hydro-lyase Eno 2 ENO2 ENOG ENOG_HUMAN Enolase 2 Enolase 2 (gamma, neuronal) Enolase 2 gamma neuronal Enolase2 Epididymis secretory protein Li 279 Gamma enolase Gamma-enolase HEL S 279 Neural enolase Neuron specific enolase Neuron specific gamma enolase Neuron-specific enolase neuronal enriched enolase Neurone specific enolase NSE |
Description | Recombinant Mouse NSE Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MGSSHHHHHHSSGLVPRGSHMGSMSIEKIWAREILDSRGNPTVEVDLYTA KGLFRAAVPSGASTGIYEALELRDGDKQRYLGKGVLKAVDHINSRIAPAL ISSGISVVEQEKLDNLMLELDGTENKSKFGANAILGVSLAVCKAGAAERD LPLYRHIAQLAGNSDLILPVPAFNVINGGSHAGNKLAMQEFMILPVGAES FRDAMRLGAEVYHTLKGVIKDKYGKDATNVGDEGGFAPNILENSEALELV KEAIDKAGYTEKMVIGMDVAASEFYRDGKYDLDFKSPADPSRYITGDQLG ALYQDFVRNYPVVSIEDPFDQDDWAAWSKFTANVGIQIVGDDLTVTNPKR IERAVEEKACNCLLLKVNQIGSVTEAIQACKLAQENGWGVMVSHRSGETE DTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLMRIEEELGDEARFAGHN FRNPSVL |
Molecular Weight | 50 kDa including tags |
Purity | >95% purity as determined by SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | Specific activity is > 10,000 pmol/min/μg, and was obtained by measuring the decrease of NAD in absorbance at 340 nm resulting from NADH at pH 6.5 at 37°C. |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |