Recombinant Mouse Myf5 Protein
Beta LifeScience
SKU/CAT #: BLA-9970P
Recombinant Mouse Myf5 Protein
Beta LifeScience
SKU/CAT #: BLA-9970P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Mouse |
Accession | P24699 |
Synonym | bHLHc2 Class C basic helix loop helix protein 2 Class C basic helix-loop-helix protein 2 Myf 5 Myf-5 Myf5 MYF5_HUMAN Myogenic factor 5 |
Description | Recombinant Mouse Myf5 Protein was expressed in Yeast. It is a Full length protein |
Source | Yeast |
AA Sequence | MDMTDGCQFSPSEYFYEGSCIPSPEDEFGDQFEPRVAAFGAHKAELQGSD DEEHVRAPTGHHQAGHCLMWACKACKRKSTTMDRRKAATMRERRRLKKVN QAFETLKRCTTTNPNQRLPKVEILRNAIRYIESLQELLREQVENYYSLPG QSCSEPTSPTSNCSDGMPECNSPVWSRKNSSFDSIYCPDVSNACAADKSS VSSLDCLSSIVDRITSTEPSELALQDTASLSPATSANSQPATPGPSSSRL IYHVL |
Molecular Weight | 28 kDa |
Purity | >85% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |